CAZyme Information: MGYG000004667_03192

Basic Information

• Species: Clostridium beijerinckii
• Lineage: Bacteria; Firmicutes_A; Clostridia; Clostridiales; Clostridiaceae; Clostridium; Clostridium beijerinckii
• CAZyme ID: MGYG000004667_03192
• CAZy Family: GH73
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
321		36974.88	9.2868

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004667	6180974	Isolate	United States	North America

• Gene Location: Start: 34961; End: 35926 Strand: +

Full Sequence      

MNTRKRKRGFKRFILNIIAFGIIAFAIFGVYSGYMAKYNSINLQDLNTKMYIQDADNASK
GKLQVNWKFMAAIDGVRYKNDFSKVTDSSINQLANMFIDNNKSTSVKIKNSQYKLVDLDT
VLDKLSFDKEQKEKVYKYIDDLKYIGSQKNNLKDESKQGFINDLYPEASEIYDKYGILPS
ITISQAILESGWGKSDLSTKANNLFGIKADSGWTGKKIKMSTSEYYKQKIEDYFRVYNSK
EDSIKDYGEFLSNNKRYKQSGVFQAANYLDQANAIEKAGYSTVENDKGEEIYSKLLIGVI
QEQNLQLLDFECEMNYFKDNK

Enzyme Prediction     

No EC number prediction in MGYG000004667_03192.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	166	305	1.9e-36	0.9765625

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1705	FlgJ	1.22e-44	156	309	42	188	Flagellum-specific peptidoglycan hydrolase FlgJ [Cell wall/membrane/envelope biogenesis, Cell motility].
PRK05684	flgJ	1.11e-31	155	301	150	295	flagellar assembly peptidoglycan hydrolase FlgJ.
pfam01832	Glucosaminidase	4.81e-25	166	247	2	77	Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase. This family includes Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase EC:3.2.1.96. As well as the flageller protein J that has been shown to hydrolyze peptidoglycan.
NF038016	sporang_Gsm	1.83e-24	158	305	161	308	sporangiospore maturation cell wall hydrolase GsmA. The peptidoglycan-hydrolyzing enzyme GsmA occurs in some sporangia-forming members of the Actinobacteria, such as Actinoplanes missouriensis, and is required for proper separation of spores. GsmA proteins have one or two SH3 domains N-terminal to the hydrolase domain.
PRK12713	flgJ	3.28e-24	160	282	184	311	flagellar rod assembly protein/muramidase FlgJ; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CUU46588.1	1.82e-227	1	321	1	321
AJG98005.1	9.66e-223	1	321	1	321
QES72533.1	7.93e-222	1	321	1	321
AQS03910.1	4.59e-221	1	321	1	321
AVK50314.1	6.51e-221	1	321	1	321

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3VWO_A	5.52e-18	158	282	2	131	Crystalstructure of peptidoglycan hydrolase mutant from Sphingomonas sp. A1 [Sphingomonas sp. A1]
2ZYC_A	6.80e-18	158	282	3	132	ChainA, Peptidoglycan hydrolase FlgJ [Sphingomonas sp. A1]
3K3T_A	4.75e-17	158	282	3	132	E185Amutant of peptidoglycan hydrolase from Sphingomonas sp. A1 [Sphingomonas sp. A1]
5DN5_A	9.00e-15	173	302	19	147	Structureof a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_B Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_C Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
5DN4_A	1.24e-14	173	302	19	147	Structureof the glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O32083	3.06e-22	155	309	46	198	Exo-glucosaminidase LytG OS=Bacillus subtilis (strain 168) OX=224308 GN=lytG PE=1 SV=1
Q9X9J3	1.25e-17	153	282	156	290	Peptidoglycan hydrolase FlgJ OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) OX=223926 GN=flgJ PE=3 SV=1
Q9KQ15	3.21e-15	155	282	159	291	Peptidoglycan hydrolase FlgJ OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) OX=243277 GN=flgJ PE=3 SV=2
Q9I4P4	7.32e-14	156	282	238	370	Peptidoglycan hydrolase FlgJ OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=flgJ PE=3 SV=1
P58231	1.42e-13	150	302	143	293	Peptidoglycan hydrolase FlgJ OS=Escherichia coli O157:H7 OX=83334 GN=flgJ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999126	0.000144	0.000026	0.000001	0.000001	0.000738

TMHMM  Annotations     

start	end
13	35