CAZyme Information: MGYG000004667_04344

Basic Information

• Species: Clostridium beijerinckii
• Lineage: Bacteria; Firmicutes_A; Clostridia; Clostridiales; Clostridiaceae; Clostridium; Clostridium beijerinckii
• CAZyme ID: MGYG000004667_04344
• CAZy Family: GT0
• CAZyme Description: UDP-2,4-diacetamido-2,4,6-trideoxy-beta-L-altropyranose hydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
343		39604.94	6.0797

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004667	6180974	Isolate	United States	North America

• Gene Location: Start: 82400; End: 83431 Strand: -

Full Sequence      

MKIFIRADGGEDIGLGHVMRMLVLGKELKKNNEVIFVCKNSLRGKYEAGIKKIQEYNFEV
IRISETNYISEIIEVQNKYNADLLITDSYDVDEEYFIKLKKYFKITGYVDDINKCKMDVD
FIINQNINAFNLDYSKTVNNNTKLFLGTKYCMLRDEFRKVSRNKFVNEDVNNILLTLGGM
DNNHNTLTILEKIKNSNKDIYVVIGNAFPKELTEKIYNLAEYHNNIHICENANMSELMLK
CDIAISACGSTLYELSAMRVPTIGIIVADNQKCVAEKMANMELIFDCFNIENIEKINLSE
LVSKLIEDKILRKRIIEKQKKIVDLHGVENLANKINEILIEFN

Enzyme Prediction     

No EC number prediction in MGYG000004667_04344.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR03590	PseG	1.29e-73	2	278	1	279	UDP-2,4-diacetamido-2,4,6-trideoxy-beta-L-altropyranose hydrolase. This protein is found in association with enzymes involved in the biosynthesis of pseudaminic acid, a component of polysaccharide in certain Pseudomonas strains as well as a modification of flagellin in Campylobacter and Hellicobacter. The role of this protein is unclear, although it may participate in N-acetylation in conjunction with, or in the absence of PseH (TIGR03585) as it often scores above the trusted cutoff to pfam00583 representing a family of acetyltransferases.
COG3980	SpsG	7.21e-55	1	332	1	317	Spore coat polysaccharide biosynthesis protein SpsG, predicted glycosyltransferase [Cell wall/membrane/envelope biogenesis].
cd03785	GT28_MurG	5.44e-07	2	333	1	349	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase. MurG (EC 2.4.1.227) is an N-acetylglucosaminyltransferase, the last enzyme involved in the intracellular phase of peptidoglycan biosynthesis. It transfers N-acetyl-D-glucosamine (GlcNAc) from UDP-GlcNAc to the C4 hydroxyl of a lipid-linked N-acetylmuramoyl pentapeptide (NAM). The resulting disaccharide is then transported across the cell membrane, where it is polymerized into NAG-NAM cell-wall repeat structure. MurG belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains, each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
PRK00726	murG	0.003	233	339	245	355	undecaprenyldiphospho-muramoylpentapeptide beta-N- acetylglucosaminyltransferase; Provisional
cd17507	GT28_Beta-DGS-like	0.006	173	326	200	359	beta-diglucosyldiacylglycerol synthase and similar proteins. beta-diglucosyldiacylglycerol synthase (processive diacylglycerol beta-glucosyltransferase EC 2.4.1.315) is involved in the biosynthesis of both the bilayer- and non-bilayer-forming membrane glucolipids. This family of glycosyltransferases also contains plant major galactolipid synthase (chloroplastic monogalactosyldiacylglycerol synthase 1 EC 2.4.1.46). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. The structures of the formed glycoconjugates are extremely diverse, reflecting a wide range of biological functions. The members of this family share a common GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AGF58283.1	4.16e-169	1	339	1	339
AQR96971.1	2.13e-165	1	339	1	339
QUF76874.1	5.65e-113	1	340	1	344
ABR36387.1	5.85e-113	1	340	2	345
AIU00843.1	5.85e-113	1	340	2	345

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3HBM_A	2.78e-15	2	279	2	264	ChainA, UDP-sugar hydrolase [Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819],3HBN_A Chain A, UDP-sugar hydrolase [Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q58462	3.05e-26	1	263	1	266	Uncharacterized protein MJ1062 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) OX=243232 GN=MJ1062 PE=1 SV=1
Q0P8U5	6.92e-17	1	279	1	264	UDP-2,4-diacetamido-2,4,6-trideoxy-beta-L-altropyranose hydrolase OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) OX=192222 GN=pseG PE=1 SV=1
A1W0U6	1.77e-16	1	279	1	264	UDP-2,4-diacetamido-2,4,6-trideoxy-beta-L-altropyranose hydrolase OS=Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176) OX=354242 GN=pseG PE=3 SV=1
P39627	1.21e-13	1	328	1	324	Spore coat polysaccharide biosynthesis protein SpsG OS=Bacillus subtilis (strain 168) OX=224308 GN=spsG PE=4 SV=2
O25093	3.19e-07	82	271	283	461	Pseudaminic acid cytidylyltransferase and UDP-2,4-diacetamido-2,4,6-trideoxy-beta-L-altropyranose hydrolase OS=Helicobacter pylori (strain ATCC 700392 / 26695) OX=85962 GN=HP_0326 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000056	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004667_04344.