CAZyme Information: MGYG000004668_00942

Basic Information

• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Lactobacillaceae; Limosilactobacillus
• CAZyme ID: MGYG000004668_00942
• CAZy Family: GH73
• CAZyme Description: Exo-glucosaminidase LytG

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
209		24343.97	10.3937

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004668	1185526	MAG	China	Asia

• Gene Location: Start: 14944; End: 15573 Strand: -

Full Sequence      

MAKRKRKARKRKSGVRLLIWVLVIIALFLGVYLAHHYYRIWNQQRIEEQMRRQDRQAKQT
FIKQVAPEAQAMQNSYHVCASVTIAQAILESQWGTSQLASQYHNLFGIKGTDPANSKILT
TKEYINGRWIVTKGRFRVYDSWSDSIKDHTKLMLNGTDTNKDNYQAVVQAKNYREAAQAL
QKCGYATDPDYAKKLISVIQTYKLYNYDK

Enzyme Prediction     

No EC number prediction in MGYG000004668_00942.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	66	204	9.5e-40	0.984375

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1705	FlgJ	3.92e-66	17	209	6	189	Flagellum-specific peptidoglycan hydrolase FlgJ [Cell wall/membrane/envelope biogenesis, Cell motility].
PRK08581	PRK08581	4.17e-41	53	209	315	473	amidase domain-containing protein.
smart00047	LYZ2	3.93e-38	55	208	5	147	Lysozyme subfamily 2. Eubacterial enzymes distantly related to eukaryotic lysozymes.
PRK05684	flgJ	1.29e-36	42	203	125	298	flagellar assembly peptidoglycan hydrolase FlgJ.
NF038016	sporang_Gsm	1.52e-36	55	208	157	312	sporangiospore maturation cell wall hydrolase GsmA. The peptidoglycan-hydrolyzing enzyme GsmA occurs in some sporangia-forming members of the Actinobacteria, such as Actinoplanes missouriensis, and is required for proper separation of spores. GsmA proteins have one or two SH3 domains N-terminal to the hydrolase domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QZN92635.1	1.43e-129	5	209	3	207
AMS07980.1	2.53e-126	1	209	1	210
QFV01375.1	8.94e-115	1	209	1	208
QDR72041.1	3.47e-112	1	209	1	208
AXX74791.1	3.47e-112	1	209	1	208

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5T1Q_A	3.73e-25	61	208	63	212	ChainA, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_B Chain B, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_C Chain C, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_D Chain D, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325]
3FI7_A	3.33e-23	59	208	31	183	CrystalStructure of the autolysin Auto (Lmo1076) from Listeria monocytogenes, catalytic domain [Listeria monocytogenes EGD-e]
5DN5_A	2.23e-21	84	203	29	149	Structureof a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_B Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_C Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
5DN4_A	3.19e-21	84	203	29	149	Structureof the glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
3VWO_A	1.02e-18	59	199	2	143	Crystalstructure of peptidoglycan hydrolase mutant from Sphingomonas sp. A1 [Sphingomonas sp. A1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O32083	1.00e-40	5	209	3	199	Exo-glucosaminidase LytG OS=Bacillus subtilis (strain 168) OX=224308 GN=lytG PE=1 SV=1
P0C2T5	1.24e-24	59	208	63	214	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. cremoris OX=1359 GN=acmA PE=3 SV=1
Q9CIT4	4.55e-24	59	208	63	214	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. lactis (strain IL1403) OX=272623 GN=acmA PE=3 SV=1
A2RHZ5	6.18e-24	59	208	63	214	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. cremoris (strain MG1363) OX=416870 GN=acmA PE=3 SV=1
Q2G222	8.72e-24	61	208	323	472	N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 OS=Staphylococcus aureus (strain NCTC 8325 / PS 47) OX=93061 GN=SAOUHSC_02979 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.980606	0.000599	0.000281	0.000005	0.000003	0.018542

TMHMM  Annotations     

start	end
13	35