CAZyme Information: MGYG000004727_01697

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae
• CAZyme ID: MGYG000004727_01697
• CAZy Family: GH109
• CAZyme Description: Alpha-N-acetylgalactosaminidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
409		45673.95	5.9548

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004727	2194019	MAG	China	Asia

• Gene Location: Start: 944; End: 2173 Strand: -

Full Sequence      

MKTNDSVLHIGLAGLGNRGQELLKLALLGRDNVKIACVCDVYEDRVQAAVDLIEQMDGYR
PLGVTSYEQMLIQKPDAVVIATPWETHIPFAIAAMKANIPVGCEVGGATSLDECWQLVHT
YEETHTPCMLLENCCFGQDELMVLHMVRQGLFGEVVHCEGGYRHDLREEICFGEENRHYR
LRHYKNRSGENYPTHELGPIAKVLRINRGNRMVSLTSTASCARGLNAYAKEKRGEHDLLA
TYPFAQGDVVTTVIRCAHGETITLTLDTTLPRPYSRGFHVQGTKGMYEEANRSVFLPDSG
IPYAFHNASEYRQRFDHPMWKRFVKDGVRGGHGGMDGLVFDAFFAALQQGKPMPIDVYDM
AAWMSITPLSEQSIACGSMPVAIPDFTSGAWCSRGEEEEWAYSLTQGKE

Enzyme Prediction     

No EC number prediction in MGYG000004727_01697.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH109	7	392	8.7e-147	0.9824561403508771

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0673	MviM	1.13e-17	8	356	4	341	Predicted dehydrogenase [General function prediction only].
pfam01408	GFO_IDH_MocA	4.48e-13	8	129	1	117	Oxidoreductase family, NAD-binding Rossmann fold. This family of enzymes utilize NADP or NAD. This family is called the GFO/IDH/MOCA family in swiss-prot.
COG1712	COG1712	0.003	8	101	1	87	Predicted dinucleotide-utilizing enzyme [General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALS29040.1	1.10e-173	1	394	1	398
QTH43530.1	1.07e-165	8	394	5	398
QTH41319.1	1.44e-162	1	391	1	397
QUO31207.1	6.17e-155	8	394	4	398
QJD87109.1	1.43e-153	1	391	1	394

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2IXA_A	1.15e-99	4	391	17	431	A-zyme,N-acetylgalactosaminidase [Elizabethkingia meningoseptica],2IXB_A Crystal structure of N-ACETYLGALACTOSAMINIDASE in complex with GalNAC [Elizabethkingia meningoseptica]
6T2B_A	1.68e-76	8	391	43	438	Glycosidehydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_B Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_C Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_D Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila]
3E18_A	6.28e-08	10	159	11	150	CRYSTALSTRUCTURE OF NAD-BINDING PROTEIN FROM Listeria innocua [Listeria innocua],3E18_B CRYSTAL STRUCTURE OF NAD-BINDING PROTEIN FROM Listeria innocua [Listeria innocua]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B2FLK4	1.32e-103	9	394	35	444	Glycosyl hydrolase family 109 protein OS=Stenotrophomonas maltophilia (strain K279a) OX=522373 GN=Smlt4431 PE=3 SV=1
A4Q8G1	3.22e-99	4	394	49	462	Alpha-N-acetylgalactosaminidase OS=Tannerella forsythia OX=28112 GN=nagA PE=3 SV=1
A4Q8F7	6.28e-99	4	391	17	431	Alpha-N-acetylgalactosaminidase OS=Elizabethkingia meningoseptica OX=238 GN=nagA PE=1 SV=1
A6LB54	1.20e-95	4	394	46	460	Glycosyl hydrolase family 109 protein OS=Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / CIP 104284 / JCM 5825 / NCTC 11152) OX=435591 GN=BDI_1155 PE=3 SV=1
Q01S58	5.60e-83	2	394	38	435	Glycosyl hydrolase family 109 protein OS=Solibacter usitatus (strain Ellin6076) OX=234267 GN=Acid_6590 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000082	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004727_01697.