CAZyme Information: MGYG000004731_00025

Basic Information

• Species: Bifidobacterium italicum
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Actinomycetales; Bifidobacteriaceae; Bifidobacterium; Bifidobacterium italicum
• CAZyme ID: MGYG000004731_00025
• CAZy Family: GT39
• CAZyme Description: putative dolichyl-phosphate-mannose--protein mannosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
542		60839.4	8.723

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004731	1853599	MAG	China	Asia

• Gene Location: Start: 5927; End: 7555 Strand: -

Full Sequence      

MMSVARSFANVMFAATRPRHGRRMAGAAGGGARGLRTPPPSAPVSWGLTLIVALFGALLR
IVRLGEPRAVVFDETYYVKDAWTMLATGEPRDWPDSVVYDGASVSPNIPFAAGDVDGWLD
SAEYVVHPPMGKWLIALGLRLCGGAQHVWAWRIATALAGVAAIVILIRLALRLWHNMPIA
LVAGYLMAIDGVGIVLSRTGLLDNFIMVFALGAFMLLVMHRDWSRRRLFAAHEADPDARP
PQIACSWYRVGAAVLLGLTTGVKWSGTYFFAVFCVISVLWDAWLYHQAGYRRWFLNAGLG
SGLLAALYMVPLYALSYLATWIGWFIHPDSYMHDWALSHPGRGVAWLPPTLRSLVEYHRQ
MWQFHTTLDAPHDYKANPLTWPLQIRPTSFYWEKPSGHPGLCSLAPKSECVAAVTSLGNP
IIWWLGSLCTLVAIGIAIWRRGDWRIWAVLAGFLAGWLPWAQYLHRTTFTFYSIVLLPWI
ILAICYVLDWIRETCTPAPWHATLCCVLVVTTLVSIFFYPIWTAMPVPYEFWLSHMWLDS
WI

Enzyme Prediction     

No EC number prediction in MGYG000004731_00025.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT39	52	325	1.2e-60	0.9910313901345291

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1928	PMT1	3.61e-20	337	542	484	694	Dolichyl-phosphate-mannose--protein O-mannosyl transferase [Posttranslational modification, protein turnover, chaperones].
pfam16192	PMT_4TMC	5.24e-15	352	539	1	198	C-terminal four TMM region of protein-O-mannosyltransferase. PMT_4TMC is the C-terminal four membrane-pass region of protein-O-mannosyltransferases and similar enzymes.
pfam02366	PMT	1.91e-08	51	283	2	201	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.
COG1807	ArnT	1.36e-07	45	327	6	235	4-amino-4-deoxy-L-arabinose transferase or related glycosyltransferase of PMT family [Cell wall/membrane/envelope biogenesis].
pfam13231	PMT_2	1.72e-06	126	228	1	98	Dolichyl-phosphate-mannose-protein mannosyltransferase. This family contains members that are not captured by pfam02366.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATU21128.1	0.0	48	542	1	495
AIZ16884.1	8.12e-292	40	542	33	533
ATO40593.1	2.87e-290	44	542	1	497
ASW24379.1	3.83e-290	40	542	33	533
ADG34083.1	2.75e-265	39	542	29	537

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
L8F4Z2	2.00e-63	38	541	26	515	Probable dolichyl-phosphate-mannose--protein mannosyltransferase OS=Mycolicibacterium smegmatis (strain MKD8) OX=1214915 GN=pmt PE=3 SV=1
P9WN04	3.54e-58	37	541	25	521	Probable dolichyl-phosphate-mannose--protein mannosyltransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=pmt PE=3 SV=2
P9WN05	3.54e-58	37	541	25	521	Probable dolichyl-phosphate-mannose--protein mannosyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=pmt PE=1 SV=2
Q8NRZ6	1.78e-39	51	541	40	519	Probable dolichyl-phosphate-mannose--protein mannosyltransferase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / BCRC 11384 / JCM 1318 / LMG 3730 / NCIMB 10025) OX=196627 GN=pmt PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999524	0.000477	0.000001	0.000000	0.000000	0.000001

TMHMM  Annotations     

start	end
42	64
148	170
174	196
201	220
264	286
293	315
420	439
446	464
469	491
504	526