CAZyme Information: MGYG000004739_00673

Basic Information

• Species: Actinomyces sp000220835
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Actinomycetales; Actinomycetaceae; Actinomyces; Actinomyces sp000220835
• CAZyme ID: MGYG000004739_00673
• CAZy Family: GH13
• CAZyme Description: Isoamylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
780		84442.57	4.4811

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004739	2692200	MAG	China	Asia

• Gene Location: Start: 32869; End: 35211 Strand: -

Full Sequence      

MSELTALDKTAWADATWPLGTHVDSDGGVTFAVHAPAATRLQLEIYPEALGATASAAFLL
ARGTDGVWRARLGGLEAGALVGFRAWGQNWLYDEAWAPGSAAGFIADLDEQGNRFNPNKV
LFDPYSREITHNVDTDALAGLGVDVGVFGTGGDLVDGVPRRQIDTAPYAPKGVVVDEEAA
AADKPQLPPERAIIYETGVRQFTGHPSTARLTDLLAGEPGFEDVPDIPAEYQGTYRGAGL
LAPYLRAAGVTTIEFLPVHETNASESARPGATNAWGYMTLDFFAPNRQYAADRSPGGPTR
EFKEMVSAFHAAGMEVYLDVVYNHTAEGGNWNGDVATTGFTSLGGFATAEYYQMTGDKRL
VDGATGTSNQMSYSSPAARRLVLDSLHYWSAVMGVDGFRFDLATVLGRLPADAAPDDWGA
LKRFFNEHPLLTGIAALAEAENIEVIAEAWDLWGYEVGNFPRGWGEWNGRYRDAVRRFTK
GDANTADFLNMVNGDYHHFEDNGGPQKSINFVVAHDGFNLADLVSYQTKVNDQPYPFGPS
DGGSDDNLSWDSGGDQGLRRQRLRNLWTILMFSRGVPMVVAGDEFGRTQNGNNNPWALDS
TAMRNNYAMIATNAPQRVAVEDGTGAVYHDNLGVFDSPGERVNPLFRFSTFLMRLRGRHT
CLHRAAWGDLAAGGDDVSYLFLTPAADGAPREGDRALAVHIDAPDDGFRLMINMADTPVD
FRVPAAREGRVWRRLVDTAVSAERESNCWAEGEGVAVADGAAVQPWSVLVWHEAAQPDAG

Enzyme Prediction     

EC	3.2.1.68	3.2.1.-	2.4.1.25

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH13	232	588	3.5e-113	0.9971509971509972

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd11326	AmyAc_Glg_debranch	0.0	180	659	4	433	Alpha amylase catalytic domain found in glycogen debranching enzymes. Debranching enzymes facilitate the breakdown of glycogen through glucosyltransferase and glucosidase activity. These activities are performed by a single enzyme in mammals, yeast, and some bacteria, but by two distinct enzymes in Escherichia coli and other bacteria. Debranching enzymes perform two activities: 4-alpha-D-glucanotransferase (EC 2.4.1.25) and amylo-1,6-glucosidase (EC 3.2.1.33). 4-alpha-D-glucanotransferase catalyzes the endohydrolysis of 1,6-alpha-D-glucoside linkages at points of branching in chains of 1,4-linked alpha-D-glucose residues. Amylo-alpha-1,6-glucosidase catalyzes the endohydrolysis of 1,6-alpha-D-glucoside linkages at points of branching in chains of 1,4-linked alpha-D-glucose residues. In Escherichia coli, GlgX is the debranching enzyme and malQ is the 4-alpha-glucanotransferase. TreX, an archaeal glycogen-debranching enzyme has dual activities like mammals and yeast, but is structurally similar to GlgX. TreX exists in two oligomeric states, a dimer and tetramer. Isoamylase (EC 3.2.1.68) is one of the starch-debranching enzymes that catalyzes the hydrolysis of alpha-1,6-glucosidic linkages specific in alpha-glucans such as amylopectin or glycogen and their beta-limit dextrins. The Alpha-amylase family comprises the largest family of glycoside hydrolases (GH), with the majority of enzymes acting on starch, glycogen, and related oligo- and polysaccharides. These proteins catalyze the transformation of alpha-1,4 and alpha-1,6 glucosidic linkages with retention of the anomeric center. The protein is described as having 3 domains: A, B, C. A is a (beta/alpha) 8-barrel; B is a loop between the beta 3 strand and alpha 3 helix of A; C is the C-terminal extension characterized by a Greek key. The majority of the enzymes have an active site cleft found between domains A and B where a triad of catalytic residues (Asp, Glu and Asp) performs catalysis. Other members of this family have lost the catalytic activity as in the case of the human 4F2hc, or only have 2 residues that serve as the catalytic nucleophile and the acid/base, such as Thermus A4 beta-galactosidase with 2 Glu residues (GH42) and human alpha-galactosidase with 2 Asp residues (GH31). The family members are quite extensive and include: alpha amylase, maltosyltransferase, cyclodextrin glycotransferase, maltogenic amylase, neopullulanase, isoamylase, 1,4-alpha-D-glucan maltotetrahydrolase, 4-alpha-glucotransferase, oligo-1,6-glucosidase, amylosucrase, sucrose phosphorylase, and amylomaltase.
COG1523	PulA	2.35e-141	18	757	19	688	Pullulanase/glycogen debranching enzyme [Carbohydrate transport and metabolism].
PRK03705	PRK03705	2.72e-101	1	599	1	532	glycogen debranching protein GlgX.
PRK14510	PRK14510	2.41e-89	18	726	15	649	bifunctional glycogen debranching protein GlgX/4-alpha-glucanotransferase.
cd11341	AmyAc_Pullulanase_LD-like	6.34e-47	192	594	3	373	Alpha amylase catalytic domain found in Pullulanase (also called dextrinase; alpha-dextrin endo-1,6-alpha glucosidase), limit dextrinase, and related proteins. Pullulanase is an enzyme with action similar to that of isoamylase; it cleaves 1,6-alpha-glucosidic linkages in pullulan, amylopectin, and glycogen, and in alpha-and beta-amylase limit-dextrins of amylopectin and glycogen. Pullulanases are very similar to limit dextrinases, although they differ in their action on glycogen and the rate of hydrolysis of limit dextrins. The Alpha-amylase family comprises the largest family of glycoside hydrolases (GH), with the majority of enzymes acting on starch, glycogen, and related oligo- and polysaccharides. These proteins catalyze the transformation of alpha-1,4 and alpha-1,6 glucosidic linkages with retention of the anomeric center. The protein is described as having 3 domains: A, B, C. A is a (beta/alpha) 8-barrel; B is a loop between the beta 3 strand and alpha 3 helix of A; C is the C-terminal extension characterized by a Greek key. The majority of the enzymes have an active site cleft found between domains A and B where a triad of catalytic residues (Asp, Glu and Asp) performs catalysis. Other members of this family have lost the catalytic activity as in the case of the human 4F2hc, or only have 2 residues that serve as the catalytic nucleophile and the acid/base, such as Thermus A4 beta-galactosidase with 2 Glu residues (GH42) and human alpha-galactosidase with 2 Asp residues (GH31). The family members are quite extensive and include: alpha amylase, maltosyltransferase, cyclodextrin glycotransferase, maltogenic amylase, neopullulanase, isoamylase, 1,4-alpha-D-glucan maltotetrahydrolase, 4-alpha-glucotransferase, oligo-1,6-glucosidase, amylosucrase, sucrose phosphorylase, and amylomaltase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALD00481.1	0.0	1	780	1	779
VEG28189.1	0.0	6	770	6	784
VEG55497.1	0.0	1	780	1	778
QQM67598.1	0.0	1	773	1	772
BDA65236.1	0.0	29	770	1	745

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1BF2_A	1.13e-123	19	760	7	725	StructureOf Pseudomonas Isoamylase [Pseudomonas amyloderamosa]
2VNC_A	1.90e-87	17	600	18	561	Crystalstructure of Glycogen Debranching enzyme TreX from Sulfolobus solfataricus [Saccharolobus solfataricus],2VNC_B Crystal structure of Glycogen Debranching enzyme TreX from Sulfolobus solfataricus [Saccharolobus solfataricus],2VR5_A Crystal structure of Trex from Sulfolobus Solfataricus in complex with acarbose intermediate and glucose [Saccharolobus solfataricus],2VR5_B Crystal structure of Trex from Sulfolobus Solfataricus in complex with acarbose intermediate and glucose [Saccharolobus solfataricus],2VUY_A Crystal structure of Glycogen Debranching exzyme TreX from Sulfolobus solfatarius [Saccharolobus solfataricus],2VUY_B Crystal structure of Glycogen Debranching exzyme TreX from Sulfolobus solfatarius [Saccharolobus solfataricus],7EAV_A Chain A, Glycogen debranching enzyme [Saccharolobus solfataricus],7EAV_B Chain B, Glycogen debranching enzyme [Saccharolobus solfataricus]
4J7R_A	1.07e-66	18	600	64	675	CrystalStructure of Chlamydomonas reinhardtii Isoamylase 1 (ISA1) [Chlamydomonas reinhardtii],4J7R_B Crystal Structure of Chlamydomonas reinhardtii Isoamylase 1 (ISA1) [Chlamydomonas reinhardtii],4OKD_A Crystal Structure of Chlamydomonas reinhardtii Isoamylase 1 (ISA1) in complex with maltoheptaose [Chlamydomonas reinhardtii],4OKD_B Crystal Structure of Chlamydomonas reinhardtii Isoamylase 1 (ISA1) in complex with maltoheptaose [Chlamydomonas reinhardtii]
2WSK_A	6.22e-64	18	600	11	533	Crystalstructure of Glycogen Debranching Enzyme GlgX from Escherichia coli K-12 [Escherichia coli K-12]
3WDH_A	1.82e-27	160	596	181	583	Crystalstructure of Pullulanase from Anoxybacillus sp. LM18-11 [Anoxybacillus sp. LM18-11],3WDI_A Crystal structure of Pullulanase complexed with maltotriose from Anoxybacillus sp. LM18-11 [Anoxybacillus sp. LM18-11],3WDJ_A Crystal structure of Pullulanase complexed with maltotetraose from Anoxybacillus sp. LM18-11 [Anoxybacillus sp. LM18-11]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O32611	1.65e-132	19	752	39	744	Isoamylase OS=Flavobacterium sp. OX=239 GN=iam PE=1 SV=1
P10342	1.22e-122	19	760	33	751	Isoamylase OS=Pseudomonas amyloderamosa OX=32043 GN=iam PE=1 SV=3
P26501	4.73e-122	19	760	33	751	Isoamylase OS=Pseudomonas sp. (strain SMP1) OX=72588 GN=iam PE=1 SV=1
P9WQ24	2.92e-88	10	738	18	690	Glycogen operon protein GlgX homolog OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=glgX PE=3 SV=1
P9WQ25	2.92e-88	10	738	18	690	Glycogen operon protein GlgX homolog OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=glgX PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000066	0.000002	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004739_00673.