CAZyme Information: MGYG000004750_01402

Basic Information

• Lineage: Bacteria; Desulfobacterota; Desulfovibrionia; Desulfovibrionales; Desulfovibrionaceae; Mailhella
• CAZyme ID: MGYG000004750_01402
• CAZy Family: GT9
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
141		15334.51	6.6306

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004750	1796254	MAG	China	Asia

• Gene Location: Start: 1867; End: 2292 Strand: -

Full Sequence      

MNVVLLAGPGEEETAAKVRSLAGVREDELRFLDLSGRTSLLSLAAVLGRLDDYVTNDSGP
MHLAWAQHTPVTALFGPTVQALGFAPRGRESTVIETELSCRPCGLHGHKTCPKGHFACMK
NIDPEAVWRDVERKLAARTQE

Enzyme Prediction     

No EC number prediction in MGYG000004750_01402.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT9	2	117	1.2e-29	0.4444444444444444

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03789	GT9_LPS_heptosyltransferase	1.50e-34	2	133	154	277	lipopolysaccharide heptosyltransferase and similar proteins. Lipopolysaccharide heptosyltransferase (2.4.99.B6) is involved in the biosynthesis of lipooligosaccharide (LOS). Lipopolysaccharide (LPS) is a major component of the outer membrane of gram-negative bacteria. LPS heptosyltransferase transfers heptose molecules from ADP-heptose to 3-deoxy-D-manno-octulosonic acid (KDO), a part of the inner core component of LPS. This family also contains lipopolysaccharide 1,2-N-acetylglucosaminetransferase EC 2.4.1.56 and belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
COG0859	RfaF	3.35e-25	2	137	210	332	ADP-heptose:LPS heptosyltransferase [Cell wall/membrane/envelope biogenesis].
TIGR02195	heptsyl_trn_II	5.58e-20	3	136	210	334	lipopolysaccharide heptosyltransferase II. This family consists of examples of ADP-heptose:LPS heptosyltransferase II, an enzyme of LPS inner core region biosynthesis. LPS, composed of lipid A, a core region, and O antigen, is found in the outer membrane of Gram-negative bacteria. [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
pfam01075	Glyco_transf_9	8.14e-19	2	117	139	247	Glycosyltransferase family 9 (heptosyltransferase). Members of this family belong to glycosyltransferase family 9. Lipopolysaccharide is a major component of the outer leaflet of the outer membrane in Gram-negative bacteria. It is composed of three domains; lipid A, Core oligosaccharide and the O-antigen. All of these enzymes transfer heptose to the lipopolysaccharide core.
PRK10422	PRK10422	9.50e-11	3	78	218	291	lipopolysaccharide core biosynthesis protein; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ABB38281.1	7.73e-53	2	135	208	341
AAS95535.1	3.44e-51	1	135	207	340
ABM28955.1	4.86e-51	2	135	208	340
SOB59335.1	1.37e-50	1	135	211	342
ADP86137.1	2.11e-50	1	135	286	419

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3TOV_A	1.39e-08	2	135	219	345	Thecrystal structure of the glycosyl transferase family 9 from Veillonella parvula DSM 2008 [Veillonella parvula DSM 2008],3TOV_B The crystal structure of the glycosyl transferase family 9 from Veillonella parvula DSM 2008 [Veillonella parvula DSM 2008]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000096	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004750_01402.