CAZyme Information: MGYG000004758_01618

Basic Information

• Species: Prevotella sp900553155
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900553155
• CAZyme ID: MGYG000004758_01618
• CAZy Family: GH146
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
597		67708.06	8.463

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004758	2740450	MAG	Denmark	Europe

• Gene Location: Start: 13689; End: 15482 Strand: +

Full Sequence      

MKNKFILPFLALLALPVQAKNVCSSFPMNKVHLLPSRFQDNMKRDSAWMMYIPVNSLLQS
FRNTSGAFSSREGGYMTVKKFGGWESLDCDLRGHTTGHLLSAYATLYAQTGSAAVKAKAD
SIVGGLAEVQQAYGKSGYLSAFAEGLIDRNIQGKSVWAPFYTLHKIVQGLIDQYQLCGNQ
QALDIAKGMGIWAYNKLKPLSEETRKKMIRNEFGGFNESMYQLYSLTKDERYLWVARFFY
HNEKIDPLKNGDTDLGTNHANTFIPKLLGEARNYEMFGNEDSRKAAELLFWTLVDDHAFV
TGELSDKEHLFKPSEQSKHITGYDGENCCTFNLLKLADHLFAWNPNSRIADYYERALYNH
ILGQQDPATGMVCYFTPLQTGTYRLYSTKENSFWCCVGSGFESHVKYASSIYFHSTNDLY
VNLFIPSEVDWDGTKVVQHTAFPQSSSTVLTIEGKQKNFALRLRYPSWATKMKVKVNGKN
IKATKGKDGYVAISRLWNEGDRVEVSFGMELLEVPTKDDASKVALVYGPVVMAGRLADVP
NPFSDPTKYNDYYTFNFNIPASIADKAKYPGLKHINMQDLIPFYDAHHCRYVVYWQK

Enzyme Prediction     

EC	3.2.1.185

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH146	31	533	6.1e-181	0.9960238568588469

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07944	Glyco_hydro_127	0.0	31	533	2	503	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
COG3533	COG3533	3.62e-113	72	544	44	520	Uncharacterized conserved protein, DUF1680 family [Function unknown].
pfam16375	DUF4986	5.20e-06	554	595	50	84	Domain of unknown function. This family around 150 residues locates in the C-terminal of some uncharacterized proteins in various Bacteroides and Bacillus species. The function of this family remains unknown.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALJ42763.1	1.23e-248	25	595	46	637
QUT70398.1	1.23e-248	25	595	46	637
BCA49451.1	1.74e-248	25	595	46	637
QUT42773.1	2.46e-248	25	595	46	637
QQA07126.1	3.26e-248	25	595	44	635

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6YQH_AAA	2.70e-85	18	597	20	650	ChainAAA, Acetyl-CoA carboxylase, biotin carboxylase [Bacteroides thetaiotaomicron VPI-5482]
5OPJ_A	1.46e-82	18	597	20	650	Beta-L-arabinofuranosidase[Bacteroides thetaiotaomicron]
6EX6_A	6.62e-20	150	538	125	550	TheGH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482],6EX6_B The GH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482]
4QJY_A	2.27e-16	219	531	197	558	Crystalstructure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QJY_B Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
4QK0_A	1.97e-14	219	531	197	558	Crystalstructure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_B Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_C Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_D Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
E8MGH8	5.04e-08	101	540	85	573	Non-reducing end beta-L-arabinofuranosidase OS=Bifidobacterium longum subsp. longum (strain ATCC 15707 / DSM 20219 / JCM 1217 / NCTC 11818 / E194b) OX=565042 GN=hypBA1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000525	0.998640	0.000347	0.000173	0.000157	0.000152

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004758_01618.