CAZyme Information: MGYG000004772_00655

Basic Information

• Lineage: Bacteria; Actinobacteriota; Coriobacteriia; Coriobacteriales; Coriobacteriaceae; Collinsella
• CAZyme ID: MGYG000004772_00655
• CAZy Family: CE7
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
133	MGYG000004772_111|CGC1	14141.96	4.0875

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004772	1545078	MAG	Spain	Europe

• Gene Location: Start: 1284; End: 1685 Strand: +

Full Sequence      

MPRPSDFDLFWKDRMAEADAVGLDYAIEAASVTDAVTCQLFDLWYTGMCGARLHAKYLKP
VSDEPVPLVLQFHGYPGASRSWFEQASFAGMGMALIALDCPGQGGPSEDIGGFEGTTVAG
HIVAGIDGDPANL

Enzyme Prediction     

No EC number prediction in MGYG000004772_00655.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE7	2	128	3.1e-31	0.40894568690095845

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam05448	AXE1	1.99e-28	2	133	18	149	Acetyl xylan esterase (AXE1). This family consists of several bacterial acetyl xylan esterase proteins. Acetyl xylan esterases are enzymes that hydrolyze the ester linkages of the acetyl groups in position 2 and/or 3 of the xylose moieties of natural acetylated xylan from hardwood. These enzymes are one of the accessory enzymes which are part of the xylanolytic system, together with xylanases, beta-xylosidases, alpha-arabinofuranosidases and methylglucuronidases; these are all required for the complete hydrolysis of xylan.
COG3458	Axe1	1.01e-26	2	130	19	148	Cephalosporin-C deacetylase or related acetyl esterase [Secondary metabolites biosynthesis, transport and catabolism].
COG1506	DAP2	3.62e-05	44	111	369	442	Dipeptidyl aminopeptidase/acylaminoacyl peptidase [Amino acid transport and metabolism].
PLN02298	PLN02298	3.27e-04	45	104	37	99	hydrolase, alpha/beta fold family protein

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIA32853.1	3.13e-95	1	133	18	150
AZH69971.1	4.45e-95	1	133	18	150
ATP53212.1	4.45e-95	1	133	18	150
ANU40725.1	6.46e-59	2	128	19	145
QQR06497.1	6.46e-59	2	128	19	145

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3FCY_A	2.37e-30	2	133	45	175	CrystalStructure of Acetyl Xylan Esterase 1 from Thermoanaerobacterium sp. JW/SL YS485 [Thermoanaerobacterium saccharolyticum JW/SL-YS485],3FCY_B Crystal Structure of Acetyl Xylan Esterase 1 from Thermoanaerobacterium sp. JW/SL YS485 [Thermoanaerobacterium saccharolyticum JW/SL-YS485],3FCY_C Crystal Structure of Acetyl Xylan Esterase 1 from Thermoanaerobacterium sp. JW/SL YS485 [Thermoanaerobacterium saccharolyticum JW/SL-YS485]
7CUZ_A	2.79e-21	3	133	16	146	ChainA, Acetylxylan esterase [Lactococcus lactis subsp. lactis KF147],7CUZ_B Chain B, Acetylxylan esterase [Lactococcus lactis subsp. lactis KF147],7CUZ_C Chain C, Acetylxylan esterase [Lactococcus lactis subsp. lactis KF147],7CUZ_D Chain D, Acetylxylan esterase [Lactococcus lactis subsp. lactis KF147]
6AGQ_A	1.77e-13	5	132	22	151	Acetylxylan esterase from Paenibacillus sp. R4 [Paenibacillus sp. R4],6AGQ_B Acetyl xylan esterase from Paenibacillus sp. R4 [Paenibacillus sp. R4],6AGQ_C Acetyl xylan esterase from Paenibacillus sp. R4 [Paenibacillus sp. R4],6AGQ_D Acetyl xylan esterase from Paenibacillus sp. R4 [Paenibacillus sp. R4],6AGQ_E Acetyl xylan esterase from Paenibacillus sp. R4 [Paenibacillus sp. R4],6AGQ_F Acetyl xylan esterase from Paenibacillus sp. R4 [Paenibacillus sp. R4]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000056	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004772_00655.