CAZyme Information: MGYG000004775_01052

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; UBA1390; NSJ-32
• CAZyme ID: MGYG000004775_01052
• CAZy Family: GH78
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
376		42818.81	4.7342

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004775	2980538	MAG	China	Asia

• Gene Location: Start: 4420; End: 5550 Strand: -

Full Sequence      

MKRDRWVWSGDAYQSYLLDYYSFFDQDIIKRTILALRGKDPVPSHINTIVDYSFYWLISI
WDYYHHTGDGEFVSQIYPRMKSLMEYCISRGNKDGLIEGQGNWVFIDWADMEKDGALCAM
QMLYCKALESTSQCAALLGLQEDRERYGERAAKIREMILRLYWNEERGAFVTTCRDGQPS
QQIRRHANLFAIIFGFAGEEMAQRIKTSVILNSEVPPITTPYFKFYELEALCKMGEYPTV
LAQMESYWGGMLREGATTFWEEYDPTLTGVEQCAMYDQPFDKSFCHAWGASPVYLLGRYF
LGVEPTKVGYAEFQVRPQLGGLAAMGGTVPLPDGKSVTVQVEGARVEVVTDAESGTLVLG
ERRFPIVPGQPLTVEG

Enzyme Prediction     

EC	3.2.1.40

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	2	345	1.4e-84	0.6785714285714286

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	6.10e-27	8	299	44	339	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam06202	GDE_C	1.58e-13	47	184	81	233	Amylo-alpha-1,6-glucosidase. This family includes human glycogen branching enzyme AGL. This enzyme contains a number of distinct catalytic activities. It has been shown for the yeast homolog GDB1 that mutations in this region disrupt the enzymes Amylo-alpha-1,6-glucosidase (EC:3.2.1.33).
COG3408	GDB1	6.13e-10	29	166	321	465	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].
pfam04685	DUF608	5.64e-07	60	164	108	212	Glycosyl-hydrolase family 116, catalytic region. This represents a family of archaeal, bacterial and eukaryotic glycosyl hydrolases, that belong to superfamily GH116. The primary catabolic pathway for glucosylceramide is catalysis by the lysosomal enzyme glucocerebrosidase. In higher eukaryotes, glucosylceramide is the precursor of glycosphingolipids, a complex group of ubiquitous membrane lipids. Mutations in the human protein cause motor-neurone defects in hereditary spastic paraplegia. The catalytic nucleophile, identified in UniProtKB:Q97YG8_SULSO, is a glutamine-335, with the likely acid/base at Asp-442 and the aspartates at Asp-406 and Asp-458 residues also playing a role in the catalysis of glucosides and xylosides that are beta-bound to hydrophobic groups. The family is defined as GH116, which presently includes enzymes with beta-glucosidase, EC:3.2.1.21, beta-xylosidase, EC:3.2.1.37, and glucocerebrosidase EC:3.2.1.45 activity.
COG1626	TreA	0.008	122	221	358	460	Neutral trehalase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QEL00882.1	3.71e-142	1	369	333	701
QHJ09603.1	3.97e-141	1	376	318	694
BAV05180.1	6.84e-141	1	367	325	692
QUT70971.1	3.32e-140	1	365	332	698
QRQ48848.1	5.82e-140	1	357	319	677

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3CIH_A	2.24e-132	1	365	334	700	Crystalstructure of a putative alpha-rhamnosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
2OKX_A	6.14e-41	8	342	576	918	Crystalstructure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1],2OKX_B Crystal structure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1]
4XHC_A	4.37e-27	2	301	240	543	ChainA, Alpha-L-rhamnosidase [Klebsiella oxytoca],4XHC_B Chain B, Alpha-L-rhamnosidase [Klebsiella oxytoca]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000067	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004775_01052.