CAZyme Information: MGYG000004775_01650

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; UBA1390; NSJ-32
• CAZyme ID: MGYG000004775_01650
• CAZy Family: GH127
• CAZyme Description: Non-reducing end beta-L-arabinofuranosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
611		70066.74	5.4635

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004775	2980538	MAG	China	Asia

• Gene Location: Start: 536; End: 2371 Strand: -

Full Sequence      

MMEYIPYSSVELKDGFWYSKQKLNRDVTIFAVLEQFQKTGRFDALQCNWKPGMPNKPHIF
WDSDVAKWVEAAAYILQKGPDERLESVCEWVIDQIEKNRTPEGYFNSFYLTVEPLGRWQG
RGNHELYCAGHWIEAAVAYYEATGRDRFLRMMEDFAGYIQQVFVKEQSATFVTPGHEEIE
LALYKLYRCTGKPEYRDLSKFFLDNRGVRPREPEATGTQSHVPVREQKSARGHAVRAMYL
YSAMADMARDCGDREMQEACEMLFQDIVRHKLYITGGIGSSKHGEAFSIPYDLPNKEAYA
ETCAAIGLIFFSSRLLLSQVDSIYGDVVEQVLYNGFLSGLSLDGKAFFYTNPLALCPEWL
EKDADKPKEARPWMPWLTQRVEVFGCSCCPPNVTRLLASLGGYQYTYEGDALWVHQYMDG
EAVHAGMRIRQETQYPNDGRIRLTVDGVGTLALRIPGWCSAYEIFLDGQRREGEIKRGYV
YLPLSSGRHSLELRLEMPCVLVEANPRVREDAGRVAVRRGPVVYCVESVDNGPMVSEIML
DGKAPWETEYDETCGLRILHTKGLRRNPDRFGDYLYREAVEDRIPVDVTMVPYYAFANRG
VSEMQVWLLRA

Enzyme Prediction     

No EC number prediction in MGYG000004775_01650.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH127	10	525	1.3e-171	0.9980916030534351

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3533	COG3533	3.79e-161	10	610	12	587	Uncharacterized conserved protein, DUF1680 family [Function unknown].
pfam07944	Glyco_hydro_127	1.52e-139	9	525	1	503	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AUS96918.1	1.50e-181	5	609	12	626
QHQ63226.1	4.17e-175	5	609	9	623
AZN43118.1	2.73e-169	5	608	13	654
ADH61394.1	2.89e-167	5	608	12	645
QDP39470.1	3.06e-165	5	608	6	639

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4QJY_A	8.79e-162	59	608	73	645	Crystalstructure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QJY_B Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
4QK0_A	1.27e-155	59	608	73	645	Crystalstructure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_B Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_C Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_D Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
6EX6_A	1.27e-127	5	608	10	623	TheGH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482],6EX6_B The GH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482]
3WKW_A	6.51e-116	59	611	72	659	Crystalstructure of GH127 beta-L-arabinofuranosidase HypBA1 from Bifidobacterium longum ligand free form [Bifidobacterium longum subsp. longum JCM 1217],3WKX_A Crystal structure of GH127 beta-L-arabinofuranosidase HypBA1 from Bifidobacterium longum arabinose complex form [Bifidobacterium longum subsp. longum JCM 1217],7BZL_A Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217],7DIF_A Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217],7EXV_A Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217],7EXW_A Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217]
7EXU_A	1.82e-115	59	611	72	659	ChainA, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
E8MGH8	1.04e-114	59	610	72	658	Non-reducing end beta-L-arabinofuranosidase OS=Bifidobacterium longum subsp. longum (strain ATCC 15707 / DSM 20219 / JCM 1217 / NCTC 11818 / E194b) OX=565042 GN=hypBA1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000087	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004775_01650.