CAZyme Information: MGYG000004789_01567

Basic Information

• Species: Streptococcus sp001556435
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Streptococcaceae; Streptococcus; Streptococcus sp001556435
• CAZyme ID: MGYG000004789_01567
• CAZy Family: GT1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
338		38348.33	8.0397

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004789	2137490	MAG	China	Asia

• Gene Location: Start: 4784; End: 5800 Strand: +

Full Sequence      

MGKLKIDVVIVPLSGHLYPTMNLLMPLLKNPRYDIRLFTGQQKRAVAEAAGFKVVTILEG
HEMDFERVANNKEQLGLFSAYRQLSASLDIINLVSDQLLSEWKVSRPDLVIADYVSLSGG
LVTEQMGIPWITTMATQFAIETTDGPPCFFGGMGSPKNRNQLIQQWLGRKLTRFLKYSAT
FLLRNRLKRYDFKMYDHNGRESIYSPHSILGIGMKELEIKKGFPEHYDWVGPTGGSVERC
EDYPLDLSPFANRKIVFVTCGTQLDWAKNNLIYQTKLLAKSHPECQFFVTLGLGGQEFQC
QKLMENVSVVSYLPYNEYIPQMDYVIHHGGSGIFSNVL

Enzyme Prediction     

No EC number prediction in MGYG000004789_01567.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03784	GT1_Gtf-like	2.00e-15	4	332	1	318	UDP-glycosyltransferases and similar proteins. This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics.
COG1819	YjiC	4.57e-14	5	335	3	314	UDP:flavonoid glycosyltransferase YjiC, YdhE family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCB95646.1	1.36e-240	1	334	1	334
ARC22690.1	3.19e-239	1	334	1	334
ARC49511.1	1.06e-237	1	334	1	334
VTS73325.1	6.19e-183	1	334	21	354
AMD97834.1	2.68e-182	1	334	1	334

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6KQW_A	1.07e-06	1	330	1	295	ChainA, Uncharacterized UDP-glucosyltransferase YjiC [Bacillus subtilis subsp. subtilis str. 168]
6KQX_A	1.09e-06	1	330	1	295	ChainA, Uncharacterized UDP-glucosyltransferase YjiC [Bacillus subtilis subsp. subtilis str. 168],7BOV_A Chain A, Uncharacterized UDP-glucosyltransferase YjiC [Bacillus subtilis subsp. subtilis str. 168]
4AMB_A	8.14e-06	12	338	31	321	Crystalstructure of the glycosyltransferase SnogD from Streptomyces nogalater [Streptomyces nogalater],4AMB_B Crystal structure of the glycosyltransferase SnogD from Streptomyces nogalater [Streptomyces nogalater]
4AMG_A	8.14e-06	12	338	31	321	Crystalstructure of the glycosyltransferase SnogD from Streptomyces nogalater [Streptomyces nogalater],4AMG_B Crystal structure of the glycosyltransferase SnogD from Streptomyces nogalater [Streptomyces nogalater],4AN4_A Crystal structure of the glycosyltransferase SnogD from Streptomyces nogalater [Streptomyces nogalater],4AN4_B Crystal structure of the glycosyltransferase SnogD from Streptomyces nogalater [Streptomyces nogalater],4AN4_C Crystal structure of the glycosyltransferase SnogD from Streptomyces nogalater [Streptomyces nogalater],4AN4_D Crystal structure of the glycosyltransferase SnogD from Streptomyces nogalater [Streptomyces nogalater]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8KHE4	2.69e-08	5	332	4	333	4'-demethylrebeccamycin synthase OS=Lentzea aerocolonigenes OX=68170 GN=rebG PE=1 SV=1
O34539	5.95e-06	1	330	1	295	NDP-glycosyltransferase YjiC OS=Bacillus subtilis (strain 168) OX=224308 GN=yjiC PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000054	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004789_01567.