CAZyme Information: MGYG000004793_01091

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Flavobacteriales; UBA1820; UBA1820
• CAZyme ID: MGYG000004793_01091
• CAZy Family: GT35
• CAZyme Description: Glycogen phosphorylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
362		41588.48	6.6671

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004793	1486801	MAG	China	Asia

• Gene Location: Start: 45; End: 1133 Strand: +

Full Sequence      

MYEKYGNVEDVKKHMVFTTHTPEEAGNEKHPFDMLANLSFFGNVPLDTAREISGVKDGVF
NHSLAALRMSHLANGVSKLHGEVSRHMWEHNEGIPPITHVTNAQNKSFWTDYILEQARVT
GNELLLTARKSALKKSLFDYVADQCGTILDPQALTIVWARRFAEYKRPDLLTRDMERFRR
LLENTKTPVQIIWAGKPYPSDYGAISLFNKLVDMSKHYKNMAVLVGYELWLSRKLKLGAD
IWLNNPRITREASGTSGMTAAMNGAINFSTYDGWIPEFAKDGVNSFIIPPQDFKLPPYEQ
DTRDMDNMFDILENKIIPMYYENRNGWTQMMLASMNDVVPFFDSARMVTEYYEKIYNAPV
EK

Enzyme Prediction     

No EC number prediction in MGYG000004793_01091.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT35	8	287	5e-68	0.47032640949554894

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR02094	more_P_ylases	1.91e-104	9	357	195	600	alpha-glucan phosphorylases. This family consists of known phosphorylases, and homologs believed to share the function of using inorganic phosphate to cleave an alpha 1,4 linkage between the terminal glucose residue and the rest of the polymer (maltodextrin, glycogen, etc.). The name of the glucose storage polymer substrate, and therefore the name of this enzyme, depends on the chain lengths and branching patterns. A number of the members of this family have been shown to operate on small maltodextrins, as may be obtained by utilization of exogenous sources. This family represents a distinct clade from the related family modeled by TIGR02093/pfam00343.
COG0058	GlgP	1.05e-89	11	356	301	701	Glucan phosphorylase [Carbohydrate transport and metabolism].
cd04299	GT35_Glycogen_Phosphorylase-like	1.50e-89	9	356	281	686	proteins similar to glycogen phosphorylase. This family is most closely related to the oligosaccharide phosphorylase domain family and other unidentified sequences. Oligosaccharide phosphorylase catalyzes the breakdown of oligosaccharides into glucose-1-phosphate units. They are important allosteric enzymes in carbohydrate metabolism.
cd04300	GT35_Glycogen_Phosphorylase	2.71e-12	68	357	407	794	glycogen phosphorylase and similar proteins. This is a family of oligosaccharide phosphorylases. It includes yeast and mammalian glycogen phosphorylases, plant starch/glucan phosphorylase, as well as the maltodextrin phosphorylases of bacteria. The members of this family catalyze the breakdown of oligosaccharides into glucose-1-phosphate units. They are important allosteric enzymes in carbohydrate metabolism. The allosteric control mechanisms of yeast and mammalian members of this family are different from that of bacterial members. The members of this family belong to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
PRK14986	PRK14986	5.61e-09	134	357	524	809	glycogen phosphorylase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUE50492.1	6.83e-165	1	356	195	551
QJE96872.1	3.16e-162	1	356	197	552
AOW10507.1	9.90e-159	1	357	196	554
QKJ63503.1	9.20e-157	1	357	196	554
QJW89753.1	1.55e-154	1	356	196	551

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1AHP_A	3.42e-08	130	280	504	667	ChainA, E.COLI MALTODEXTRIN PHOSPHORYLASE [Escherichia coli],1AHP_B Chain B, E.COLI MALTODEXTRIN PHOSPHORYLASE [Escherichia coli]
2ECP_A	3.42e-08	130	280	503	666	TheCrystal Structure Of The E. Coli Maltodextrin Phosphorylase Complex [Escherichia coli],2ECP_B The Crystal Structure Of The E. Coli Maltodextrin Phosphorylase Complex [Escherichia coli]
1E4O_A	1.40e-07	130	280	503	666	Phosphorylaserecognition and phosphorolysis of its oligosaccharide substrate: answers to a long outstanding question [Escherichia coli],1E4O_B Phosphorylase recognition and phosphorolysis of its oligosaccharide substrate: answers to a long outstanding question [Escherichia coli],1QM5_A Phosphorylase recognition and phosphorylysis of its oligosaccharide substrate: answers to a long outstanding question [Escherichia coli],1QM5_B Phosphorylase recognition and phosphorylysis of its oligosaccharide substrate: answers to a long outstanding question [Escherichia coli]
1L5V_A	1.40e-07	130	280	503	666	CrystalStructure of the Maltodextrin Phosphorylase complexed with Glucose-1-phosphate [Escherichia coli],1L5V_B Crystal Structure of the Maltodextrin Phosphorylase complexed with Glucose-1-phosphate [Escherichia coli],1L5W_A Crystal Structure of the Maltodextrin Phosphorylase Complexed with the Products of the Enzymatic Reaction between Glucose-1-phosphate and Maltotetraose [Escherichia coli],1L5W_B Crystal Structure of the Maltodextrin Phosphorylase Complexed with the Products of the Enzymatic Reaction between Glucose-1-phosphate and Maltotetraose [Escherichia coli],1L6I_A Crystal Structure of the Maltodextrin Phosphorylase complexed with the products of the enzymatic reaction between glucose-1-phosphate and maltopentaose [Escherichia coli],1L6I_B Crystal Structure of the Maltodextrin Phosphorylase complexed with the products of the enzymatic reaction between glucose-1-phosphate and maltopentaose [Escherichia coli],2ASV_A Chain A, Maltodextrin phosphorylase [Escherichia coli],2ASV_B Chain B, Maltodextrin phosphorylase [Escherichia coli],2AV6_A Chain A, Maltodextrin phosphorylase [Escherichia coli],2AV6_B Chain B, Maltodextrin phosphorylase [Escherichia coli],2AW3_A X-Ray studies on maltodextrin phosphorylase complexes: recognition of substrates and cathalitic mechanism of phosphorylase family [Escherichia coli],2AW3_B X-Ray studies on maltodextrin phosphorylase complexes: recognition of substrates and cathalitic mechanism of phosphorylase family [Escherichia coli],2AZD_A Chain A, Maltodextrin phosphorylase [Escherichia coli],2AZD_B Chain B, Maltodextrin phosphorylase [Escherichia coli]
7TM7_A	1.87e-07	130	280	512	675	ChainA, Alpha-1,4 glucan phosphorylase [Klebsiella pneumoniae subsp. pneumoniae HS11286],7TM7_B Chain B, Alpha-1,4 glucan phosphorylase [Klebsiella pneumoniae subsp. pneumoniae HS11286]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q59025	3.90e-83	1	357	176	519	Uncharacterized protein MJ1631 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) OX=243232 GN=MJ1631 PE=3 SV=1
Q9YGA7	1.25e-58	16	357	307	689	Maltodextrin phosphorylase OS=Thermococcus litoralis (strain ATCC 51850 / DSM 5473 / JCM 8560 / NS-C) OX=523849 GN=malP PE=1 SV=1
O66932	2.55e-47	8	357	285	685	Glycogen phosphorylase OS=Aquifex aeolicus (strain VF5) OX=224324 GN=glgP PE=3 SV=1
P9WMW1	9.62e-44	11	356	316	719	Glycogen phosphorylase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=glgP PE=1 SV=1
P9WMW0	9.62e-44	11	356	316	719	Glycogen phosphorylase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=glgP PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000054	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004793_01091.