CAZyme Information: MGYG000004799_02308

Basic Information

• Species: Schaedlerella sp900765975
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Schaedlerella; Schaedlerella sp900765975
• CAZyme ID: MGYG000004799_02308
• CAZy Family: GH73
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
425		48422.49	9.2647

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004799	2888994	MAG	China	Asia

• Gene Location: Start: 6; End: 1283 Strand: +

Full Sequence      

MHTGWLSFGSTYYYLNEKGVRQTGWQTIDGKRYYFMPDGHRHTGWLSFGSTRYYMNQLGQ
MQTGKVLIDGKEYFFNVDGKLQGSTGAGWKTINGKKYYYNAAGEKVTGWQDIDGKRYYFM
PDGHMHTGWLSFGSTYYYMMPDGHRHTGWLSFGSTYYYLNEKGVRQTGWQTIDGKRYYFM
PDGHRHTGWLSFGSTYYYMMPDGHMHTGWLSFGSTYYYLNEKGVRQTGWQTIDGKEYYFD
ENGVRMTGYEITGKTSVSASQMVQLFKKQGKAYPTKALSKGGATTIEDFVNIVYQEANAE
GIKAEVVFCQSMVETGWLQFKGDVKAEQFNFAGLGAVGNGAGGVDFSSYGINGVRMGIRA
QVQHLKCYANKDALVNPCVDPRWGDWLRGKAPYVEWLAKEKNPNNIGWATDADYGKKIIA
LIKQL

Enzyme Prediction     

No EC number prediction in MGYG000004799_02308.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	291	424	2.7e-19	0.953125

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
NF033930	pneumo_PspA	8.63e-43	22	251	442	653	pneumococcal surface protein A. The pneumococcal surface protein proteins, found in Streptococcus pneumoniae, are repetitive, with patterns of localized high sequence identity across pairs of proteins given different specific names that recombination may be presumed. This protein, PspA, has an N-terminal region that lacks a cross-wall-targeting YSIRK type extended signal peptide, in contrast to the closely related choline-binding protein CbpA which has a similar C-terminus but a YSIRK-containing region at the N-terminus.
NF033930	pneumo_PspA	1.83e-42	88	300	444	658	pneumococcal surface protein A. The pneumococcal surface protein proteins, found in Streptococcus pneumoniae, are repetitive, with patterns of localized high sequence identity across pairs of proteins given different specific names that recombination may be presumed. This protein, PspA, has an N-terminal region that lacks a cross-wall-targeting YSIRK type extended signal peptide, in contrast to the closely related choline-binding protein CbpA which has a similar C-terminus but a YSIRK-containing region at the N-terminus.
NF033930	pneumo_PspA	5.90e-42	3	243	443	657	pneumococcal surface protein A. The pneumococcal surface protein proteins, found in Streptococcus pneumoniae, are repetitive, with patterns of localized high sequence identity across pairs of proteins given different specific names that recombination may be presumed. This protein, PspA, has an N-terminal region that lacks a cross-wall-targeting YSIRK type extended signal peptide, in contrast to the closely related choline-binding protein CbpA which has a similar C-terminus but a YSIRK-containing region at the N-terminus.
NF033838	PspC_subgroup_1	4.08e-40	69	243	492	663	pneumococcal surface protein PspC, choline-binding form. The pneumococcal surface protein PspC, as described in Streptococcus pneumoniae, is a repetitive and highly variable protein, recognized by a conserved N-terminal domain and also by genomic location. This form, subgroup 1, has variable numbers of a choline-binding repeat in the C-terminal region, and is also known as choline-binding protein A. The other form, subgroup 2, is anchored covalently after cleavage by sortase at a C-terminal LPXTG site.
NF033838	PspC_subgroup_1	5.96e-40	22	243	485	680	pneumococcal surface protein PspC, choline-binding form. The pneumococcal surface protein PspC, as described in Streptococcus pneumoniae, is a repetitive and highly variable protein, recognized by a conserved N-terminal domain and also by genomic location. This form, subgroup 1, has variable numbers of a choline-binding repeat in the C-terminal region, and is also known as choline-binding protein A. The other form, subgroup 2, is anchored covalently after cleavage by sortase at a C-terminal LPXTG site.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ASM68313.1	1.70e-63	250	425	879	1049
CBL24117.1	2.15e-55	251	425	102	271
QBE99413.1	2.43e-53	251	425	922	1091
QMW77434.1	2.82e-52	251	425	922	1091
QIB58002.1	2.82e-52	251	425	922	1091

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O51481	1.26e-15	287	425	65	195	Uncharacterized protein BB_0531 OS=Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31) OX=224326 GN=BB_0531 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000040	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004799_02308.