CAZyme Information: MGYG000004800_00384

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; TANB77; CAG-508; CAG-269
• CAZyme ID: MGYG000004800_00384
• CAZy Family: GT4
• CAZyme Description: Alpha-monoglucosyldiacylglycerol synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
381		44146.93	9.4765

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004800	1526094	MAG	Denmark	Europe

• Gene Location: Start: 6133; End: 7278 Strand: +

Full Sequence      

MKILIVIDQYDGANNGTTISARRFVKYLRKNGNTVKVLSTGQKEVDKYVLKEVKLIPIAK
QIIKSQGMTFAKVDKEILETAIKEADIVHFYMPFKLSIEGMKIAKKLNKPMTAAFHVQPE
NITSTLKLGNNEKVNNKIYELFRDKFYNNFTHIHCPSNFIANQLKEHGYNSKLHVISNGI
EKDFKYNKTEKPEEFKEKIIITMVGRLSEEKRQDLLIEAVKKSKYSEKIQLIFAGKGPKK
RGYVKLGKTLKNEPIFEFYKKEELKNILSFTDIYVHTADAEIEAISCIEAFATGLVPIIA
NSNKSATTQFAIDERSLFEAGNSDDLANKIDYWLENEQERKNMEKIYAEQAEKYRIENSI
EKIEEMFKEEIDERRSERIIR

Enzyme Prediction     

No EC number prediction in MGYG000004800_00384.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT4	195	345	2.9e-23	0.9625

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03817	GT4_UGDG-like	8.43e-66	2	366	1	371	UDP-Glc:1,2-diacylglycerol 3-a-glucosyltransferase and similar proteins. This family is most closely related to the GT1 family of glycosyltransferases. UDP-glucose-diacylglycerol glucosyltransferase (EC 2.4.1.337, UGDG; also known as 1,2-diacylglycerol 3-glucosyltransferase) catalyzes the transfer of glucose from UDP-glucose to 1,2-diacylglycerol forming 3-D-glucosyl-1,2-diacylglycerol.
cd03801	GT4_PimA-like	2.07e-41	2	368	1	366	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
COG0438	RfaB	4.87e-39	1	374	1	381	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
cd03814	GT4-like	9.94e-25	2	363	1	356	glycosyltransferase family 4 proteins. This family is most closely related to the GT4 family of glycosyltransferases and includes a sequence annotated as alpha-D-mannose-alpha(1-6)phosphatidyl myo-inositol monomannoside transferase from Bacillus halodurans. Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in bacteria and eukaryotes.
cd03794	GT4_WbuB-like	1.18e-22	2	364	1	391	Escherichia coli WbuB and similar proteins. This family is most closely related to the GT1 family of glycosyltransferases. WbuB in E. coli is involved in the biosynthesis of the O26 O-antigen. It has been proposed to function as an N-acetyl-L-fucosamine (L-FucNAc) transferase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADO38766.1	1.67e-142	1	373	1	373
QCT71572.1	3.88e-141	1	373	1	373
ALU13529.1	3.88e-141	1	373	1	373
ARD65372.1	8.35e-141	1	373	1	373
QCI58773.1	1.04e-131	1	375	1	375

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3QHP_A	1.57e-41	201	360	5	164	Crystalstructure of the catalytic domain of cholesterol-alpha-glucosyltransferase from Helicobacter pylori [Helicobacter pylori 26695],3QHP_B Crystal structure of the catalytic domain of cholesterol-alpha-glucosyltransferase from Helicobacter pylori [Helicobacter pylori 26695]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8CWR6	3.87e-11	1	303	1	315	Alpha-monoglucosyldiacylglycerol synthase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) OX=171101 GN=spr0982 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000064	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004800_00384.