CAZyme Information: MGYG000004802_00289

Basic Information

• Species: UMGS1384 sp900551265
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Butyricicoccaceae; UMGS1384; UMGS1384 sp900551265
• CAZyme ID: MGYG000004802_00289
• CAZy Family: GH63
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
605	MGYG000004802_9|CGC1	68934.53	4.889

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004802	2084927	MAG	Spain	Europe

• Gene Location: Start: 11426; End: 13243 Strand: +

Full Sequence      

MNYDTMRRDMLKGFNTYDTYSVLSHVLLPEGFAIRLGLKNRVDKSILRNALIGRFGDQEE
HIHPGVRTVDGSYTQLELEYRGAKLRIRSAAQDRDQYILIEPENERCRELILFMECGFLW
NRPGAAYLRGDCIEGVTDGGSIRVYMTGSDTRELHLGGFGVTRVSDLNEPVAVSTGREAT
VDEVRARIERACMAAQVSASKYGELAEAYVAMRTGYAWNTIYEPEHQRICSPVSRIWNIN
WGGYVLFDWDTYFCALMASPESRELAYANAFAITNEATERGFIPNFGAAGDNKSRDRSQP
PVGAMTFRELYRRYGEKWILEESFDTLLSWNRWFAKNRMLKNGTMCWGSDQIAQPFASFD
VNNHQAAEYESGLDNSPMFDGALFDPETGLMQLADVGLTGLYCMDCEALADIARILDRSE
REEILERGRRADHGMQTLWDEEAGMFLNRDLTTGELSHRMGPTNFYAGFCPSVTPQQAER
LCAHYFNPQEFYGEYVIPTIARNDPAYSDQMYWRGRIWAPTNFLAYLAFRRMGAYDVCRD
LAEKSASLILKEWRKYGHIHENYSGDDGWGCPNPRSDKFYHWGGLLTLIALIEAGYVEAP
EGLLD

Enzyme Prediction     

No EC number prediction in MGYG000004802_00289.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH63	224	568	1.8e-25	0.35789473684210527

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK10137	PRK10137	9.19e-12	224	573	304	768	alpha-glucosidase; Provisional
pfam01204	Trehalase	1.70e-09	249	563	131	473	Trehalase. Trehalase (EC:3.2.1.28) is known to recycle trehalose to glucose. Trehalose is a physiological hallmark of heat-shock response in yeast and protects of proteins and membranes against a variety of stresses. This family is found in conjunction with pfam07492 in fungi.
COG3408	GDB1	1.09e-06	244	604	282	616	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].
COG1626	TreA	3.29e-06	246	544	172	498	Neutral trehalase [Carbohydrate transport and metabolism].
pfam03200	Glyco_hydro_63	5.09e-06	487	589	377	491	Glycosyl hydrolase family 63 C-terminal domain. This is a family of eukaryotic enzymes belonging to glycosyl hydrolase family 63. They catalyze the specific cleavage of the non-reducing terminal glucose residue from Glc(3)Man(9)GlcNAc(2). Mannosyl oligosaccharide glucosidase EC:3.2.1.106 is the first enzyme in the N-linked oligosaccharide processing pathway. This family represents the C-terminal catalytic domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNK58860.1	2.88e-193	3	601	18	622
QTH44429.1	3.81e-188	3	603	17	623
QNI32096.1	1.67e-180	6	593	1	600
QTD47584.1	1.50e-163	3	605	30	636
QLE02613.1	1.58e-154	4	598	32	624

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3W7S_A	4.76e-07	224	573	277	741	Escherichiacoli K12 YgjK complexed with glucose [Escherichia coli K-12],3W7S_B Escherichia coli K12 YgjK complexed with glucose [Escherichia coli K-12],3W7T_A Escherichia coli K12 YgjK complexed with mannose [Escherichia coli K-12],3W7T_B Escherichia coli K12 YgjK complexed with mannose [Escherichia coli K-12],3W7U_A Escherichia coli K12 YgjK complexed with galactose [Escherichia coli K-12],3W7U_B Escherichia coli K12 YgjK complexed with galactose [Escherichia coli K-12]
3W7X_A	1.88e-06	224	573	277	741	Crystalstructure of E. coli YgjK D324N complexed with melibiose [Escherichia coli K-12],3W7X_B Crystal structure of E. coli YgjK D324N complexed with melibiose [Escherichia coli K-12],5CA3_A Crystal structure of the glycosynthase mutant D324N of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12],5CA3_B Crystal structure of the glycosynthase mutant D324N of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12]
3W7W_A	2.48e-06	224	573	277	741	Crystalstructure of E. coli YgjK E727A complexed with 2-O-alpha-D-glucopyranosyl-alpha-D-galactopyranose [Escherichia coli K-12],3W7W_B Crystal structure of E. coli YgjK E727A complexed with 2-O-alpha-D-glucopyranosyl-alpha-D-galactopyranose [Escherichia coli K-12],5GW7_A Crystal structure of the glycosynthase mutant E727A of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12],5GW7_B Crystal structure of the glycosynthase mutant E727A of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12]
3D3I_A	5.65e-06	224	573	278	742	Crystalstructural of Escherichia coli K12 YgjK, a glucosidase belonging to glycoside hydrolase family 63 [Escherichia coli K-12],3D3I_B Crystal structural of Escherichia coli K12 YgjK, a glucosidase belonging to glycoside hydrolase family 63 [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
D8QTR2	1.81e-08	232	571	89	469	Mannosylglycerate hydrolase MGH1 OS=Selaginella moellendorffii OX=88036 GN=MGH PE=1 SV=1
D8T3S4	3.16e-08	232	571	89	469	Mannosylglycerate hydrolase MGH2 OS=Selaginella moellendorffii OX=88036 GN=SELMODRAFT_447962 PE=3 SV=1
P42592	2.63e-06	224	573	300	764	Glucosidase YgjK OS=Escherichia coli (strain K12) OX=83333 GN=ygjK PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000053	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004802_00289.