CAZyme Information: MGYG000004839_02449

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; GCA-900066135
• CAZyme ID: MGYG000004839_02449
• CAZy Family: GH36
• CAZyme Description: Bifunctional alpha-galactosidase/sucrose kinase AgaSK

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
740	MGYG000004839_91|CGC1	84320.14	5.3785

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004839	3024091	MAG	China	Asia

• Gene Location: Start: 7990; End: 10212 Strand: -

Full Sequence      

MAILYDQKQKLFTLLTEHTMYQMKVDDCQVLLHTYYGKRTQVCDYSYRITYADHGFSGVP
YEKGNHRGYSLDILPQEYPSYGGGDYRESALKLRFTNGAQACELRYAGYEILPGKYQIPG
LPAVYDTEPGADQEGKAADGLNAETLAVYLKDQTGQVQVRLLYGVLEELDMITRAAEIKN
IGTEPLFLERAFSMSMDFQHMDLEAVSFHGRHAKERTLQRKPVDYGTQVYGSTRGASSHQ
MNPFLILCSPDAEEERGYCYGFSFLYSGNFYGAVQKDQMDSVRAVLGIHPDDFCWKLMPE
ESFHTPEAAMVFSEKGFGTLSRRYHKAYRHHLCRGRWKTARRPILLNSWEGVYFDFNGEK
LATMAKEAADLGIELFVMDDGWFGKRDDDNSGLGDWIVNEKKLGCSLGELSRQIHGFGMK
FGIWFEPECVSEDSDLYRAHPDWAVKVPGKPPVRSRNQLILDFSRKEVRTFIFEEMCQVL
DGAQIDYVKWDFNRSISDWYSAARPADRQGETAHRYILGLYEVLEALRKRYPDLLIEGCS
GGGGRFDAGMLYYTPQIWCSDDTDAVERLSIQYGTSFGYSISTMGAHVSKCPNEQTGRYT
PFETRAVTAMAGTFGYELDVNKMTEEDKKAVREQIGRFKEHYRLIQDGEYYRLTDPENNK
GFHAWEFVSEDKTEALICGVALKILPNGPGYLVFPKGLDAGKQYRIHDQILPGDALMEAG
IPVPEIREEYGSAWIYFQAV

Enzyme Prediction     

No EC number prediction in MGYG000004839_02449.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH36	12	722	6.4e-260	0.9956395348837209

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam02065	Melibiase	0.0	302	648	1	347	Melibiase. Glycoside hydrolase families GH27, GH31 and GH36 form the glycoside hydrolase clan GH-D. Glycoside hydrolase family 36 can be split into 11 families, GH36A to GH36K. This family includes enzymes from GH36A-B and GH36D-K and from GH27.
COG3345	GalA	9.40e-178	23	731	13	675	Alpha-galactosidase [Carbohydrate transport and metabolism].
cd14791	GH36	1.97e-138	341	640	1	299	glycosyl hydrolase family 36 (GH36). GH36 enzymes occur in prokaryotes, eukaryotes, and archaea with a wide range of hydrolytic activities, including alpha-galactosidase, alpha-N-acetylgalactosaminidase, stachyose synthase, and raffinose synthase. All GH36 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH36 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.
pfam16875	Glyco_hydro_36N	8.51e-108	31	297	3	255	Glycosyl hydrolase family 36 N-terminal domain. This domain is found at the N-terminus of many family 36 glycoside hydrolases. It has a beta-supersandwich fold.
pfam16874	Glyco_hydro_36C	3.11e-16	664	737	3	78	Glycosyl hydrolase family 36 C-terminal domain. This domain is found at the C-terminus of many family 36 glycoside hydrolases. It has a beta-sandwich structure with a Greek key motif.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ASU30552.1	0.0	1	732	1	721
ANU77746.1	0.0	1	732	1	721
QQQ95349.1	0.0	1	732	1	721
QJU16478.1	0.0	1	732	1	721
QBE96096.1	0.0	1	732	1	721

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2YFN_A	1.16e-272	1	730	1	710	galactosidasedomain of alpha-galactosidase-sucrose kinase, AgaSK [[Ruminococcus] gnavus E1],2YFO_A GALACTOSIDASE DOMAIN OF ALPHA-GALACTOSIDASE-SUCROSE KINASE, AGASK, in complex with galactose [[Ruminococcus] gnavus E1]
4FNQ_A	5.58e-232	1	740	1	727	Crystalstructure of GH36 alpha-galactosidase AgaB from Geobacillus stearothermophilus [Geobacillus stearothermophilus]
4FNR_A	2.68e-227	1	740	1	727	Crystalstructure of GH36 alpha-galactosidase AgaA from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4FNR_B Crystal structure of GH36 alpha-galactosidase AgaA from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4FNR_C Crystal structure of GH36 alpha-galactosidase AgaA from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4FNR_D Crystal structure of GH36 alpha-galactosidase AgaA from Geobacillus stearothermophilus [Geobacillus stearothermophilus]
4FNU_A	2.46e-225	1	740	1	727	Crystalstructure of GH36 alpha-galactosidase AgaA A355E D478A from Geobacillus stearothermophilus in complex with stachyose [Geobacillus stearothermophilus],4FNU_B Crystal structure of GH36 alpha-galactosidase AgaA A355E D478A from Geobacillus stearothermophilus in complex with stachyose [Geobacillus stearothermophilus],4FNU_C Crystal structure of GH36 alpha-galactosidase AgaA A355E D478A from Geobacillus stearothermophilus in complex with stachyose [Geobacillus stearothermophilus],4FNU_D Crystal structure of GH36 alpha-galactosidase AgaA A355E D478A from Geobacillus stearothermophilus in complex with stachyose [Geobacillus stearothermophilus]
4FNP_A	2.46e-225	1	740	1	727	Crystalstructure of GH36 alpha-galactosidase AgaA A355E from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4FNP_B Crystal structure of GH36 alpha-galactosidase AgaA A355E from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4FNP_C Crystal structure of GH36 alpha-galactosidase AgaA A355E from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4FNP_D Crystal structure of GH36 alpha-galactosidase AgaA A355E from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4FNS_A Crystal structure of GH36 alpha-galactosidase AgaA A355E from Geobacillus stearothermophilus in complex with 1-deoxygalactonojirimycin [Geobacillus stearothermophilus],4FNS_B Crystal structure of GH36 alpha-galactosidase AgaA A355E from Geobacillus stearothermophilus in complex with 1-deoxygalactonojirimycin [Geobacillus stearothermophilus],4FNS_C Crystal structure of GH36 alpha-galactosidase AgaA A355E from Geobacillus stearothermophilus in complex with 1-deoxygalactonojirimycin [Geobacillus stearothermophilus],4FNS_D Crystal structure of GH36 alpha-galactosidase AgaA A355E from Geobacillus stearothermophilus in complex with 1-deoxygalactonojirimycin [Geobacillus stearothermophilus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
G4T4R7	9.50e-269	1	730	1	710	Bifunctional alpha-galactosidase/sucrose kinase AgaSK OS=Ruminococcus gnavus OX=33038 GN=agaSK PE=1 SV=1
Q9ALJ4	1.47e-226	1	740	1	727	Alpha-galactosidase AgaA OS=Geobacillus stearothermophilus OX=1422 GN=agaA PE=1 SV=1
G1UB44	3.38e-215	3	740	6	731	Alpha-galactosidase Mel36A OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) OX=272621 GN=melA PE=1 SV=1
P43467	1.17e-210	6	740	7	730	Alpha-galactosidase 1 OS=Pediococcus pentosaceus OX=1255 GN=agaR PE=3 SV=1
Q0CEF5	1.58e-174	55	738	61	723	Probable alpha-galactosidase G OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=aglG PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000029	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004839_02449.