CAZyme Information: MGYG000004858_00728

Basic Information

• Lineage: Bacteria; Firmicutes_C; Negativicutes; Veillonellales; Veillonellaceae; Veillonella
• CAZyme ID: MGYG000004858_00728
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
301		33724.22	5.6004

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004858	906876	MAG	China	Asia

• Gene Location: Start: 26; End: 931 Strand: +

Full Sequence      

MMKEKPDILVCVDYPGFNMKLAAVAHELEIPVLYYIAPTIWAWHSSRGNTIRKYVTKVAS
IFPFEAEAYRKYKCDVDFVGHPLLDIVHPTMTKDAAEEYFGARKEAKKVLLMPGSRKQEV
LSLLDTMLKSGEQLMANHEDIQFFLPRAHTIDRSELEAFIDAHKVPVTITEDHTYDLMQI
CDVCLAASGTATLETAMMELPTVLLYRVSPITYGIGKMVVNVTHVGLPNIVAGKEVIPEL
LQDAVTPDAIVSLVEPLLSDVDKNEAMRSELREVRHKLGEPGAVKRVAELVYNLGKEKCN
E

Enzyme Prediction     

No EC number prediction in MGYG000004858_00728.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	2	279	7.9e-96	0.7740112994350282

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	4.11e-108	4	294	84	374	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	5.91e-90	1	297	81	381	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	3.18e-69	1	280	78	363	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	4.14e-64	1	294	85	385	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	1.36e-42	2	294	73	347	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SNU95574.1	1.30e-213	1	301	80	380
ACZ24221.1	1.30e-213	1	301	80	380
QQB16511.1	1.30e-213	1	301	80	380
CAB1276542.1	1.24e-211	1	301	80	380
BBU36764.1	4.15e-210	1	301	80	380

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8S_A	1.99e-45	5	278	90	365	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]
5W8N_A	1.08e-44	5	278	90	365	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q74AT9	5.19e-81	1	297	86	383	Lipid-A-disaccharide synthase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) OX=243231 GN=lpxB PE=3 SV=1
Q2LVL8	1.81e-78	1	297	83	380	Lipid-A-disaccharide synthase OS=Syntrophus aciditrophicus (strain SB) OX=56780 GN=lpxB PE=3 SV=1
B3E4H8	1.15e-76	1	294	86	379	Lipid-A-disaccharide synthase OS=Trichlorobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) OX=398767 GN=lpxB PE=3 SV=1
Q39T49	2.65e-75	6	298	91	384	Lipid-A-disaccharide synthase OS=Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15) OX=269799 GN=lpxB PE=3 SV=1
Q3A550	9.38e-75	4	297	91	384	Lipid-A-disaccharide synthase OS=Syntrophotalea carbinolica (strain DSM 2380 / NBRC 103641 / GraBd1) OX=338963 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000058	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004858_00728.