CAZyme Information: MGYG000004860_02174

Basic Information

• Species: Levilactobacillus namurensis
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Lactobacillaceae; Levilactobacillus; Levilactobacillus namurensis
• CAZyme ID: MGYG000004860_02174
• CAZy Family: GH8
• CAZyme Description: Endoglucanase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
376		42536.94	11.3651

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004860	2610545	MAG	China	Asia

• Gene Location: Start: 2043; End: 3173 Strand: +

Full Sequence      

MQKLRLRVWLGGLLVAGGVCLGLWGQAAIPAQAKSSQAVTWYRQWKKAYVRGGQQKYVQT
NDGHGASRVYSEGQGYGMLASVLAAKRGVKTHTTFNQLYRYYRAHRVSKANPLMQWQQIK
RQGKLTSVGSERNSATDGDLDIAYALILADKQWGSRKINYRQAARQLLVAIQRSEINPTT
HLPMMGNWATTANDQRKLRTADLMTGYFRAFAKVSQKAKWTRTANQSQKMVKKLSAQHKT
GLFPDFTYVTGKHLTRRSVRPNTIESATDNQVGYNACRVPWRLAQTYRLTHDATTKRALT
KQLNFFQRRSKVTAVYTLGGRAVYTYQNAAFTAPVVTAARVLKRSTLQRKFAKQLPAKIQ
KHDYYSATLQMITAFA

Enzyme Prediction     

No EC number prediction in MGYG000004860_02174.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH8	42	374	2e-75	0.978125

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01270	Glyco_hydro_8	1.61e-22	42	372	8	314	Glycosyl hydrolases family 8.
COG3405	BcsZ	1.83e-14	27	280	16	248	Endo-1,4-beta-D-glucanase Y [Carbohydrate transport and metabolism].
PRK11097	PRK11097	3.89e-09	16	279	5	249	cellulase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMU08254.1	1.33e-171	4	374	1	374
QFR62356.1	1.07e-167	4	374	1	371
AYM02428.1	1.51e-167	12	376	9	373
QCZ54014.1	4.48e-167	24	374	21	372
QCZ44379.1	6.35e-167	24	374	21	372

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5XD0_A	1.31e-45	45	339	69	364	ApoStructure of Beta-1,3-1,4-glucanase from Paenibacillus sp.X4 [Paenibacillus sp. X4],5XD0_B Apo Structure of Beta-1,3-1,4-glucanase from Paenibacillus sp.X4 [Paenibacillus sp. X4]
1V5C_A	4.57e-26	29	339	22	340	Thecrystal structure of the inactive form chitosanase from Bacillus sp. K17 at pH3.7 [Bacillus sp. (in: Bacteria)],1V5D_A The crystal structure of the active form chitosanase from Bacillus sp. K17 at pH6.4 [Bacillus sp. (in: Bacteria)],1V5D_B The crystal structure of the active form chitosanase from Bacillus sp. K17 at pH6.4 [Bacillus sp. (in: Bacteria)]
7CJU_A	5.18e-26	29	339	28	346	Crystalstructure of inactive form of chitosanase crystallized by ammonium sulfate [Bacillus sp. K17-2],7CJU_B Crystal structure of inactive form of chitosanase crystallized by ammonium sulfate [Bacillus sp. K17-2],7XGQ_A Chain A, chitosanase [Bacillus sp. K17-2],7XGQ_B Chain B, chitosanase [Bacillus sp. K17-2]
1CEM_A	2.28e-22	71	373	62	348	ChainA, CELLULASE CELA (1,4-BETA-D-GLUCAN-GLUCANOHYDROLASE) [Acetivibrio thermocellus],1IS9_A Chain A, endoglucanase A [Acetivibrio thermocellus]
1KWF_A	5.10e-21	71	373	62	348	ChainA, Endoglucanase A [Acetivibrio thermocellus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P19254	3.66e-45	29	339	53	364	Beta-glucanase OS=Niallia circulans OX=1397 GN=bgc PE=3 SV=1
P29019	1.43e-22	29	338	78	395	Endoglucanase OS=Bacillus sp. (strain KSM-330) OX=72575 PE=1 SV=1
A3DC29	2.68e-20	71	373	94	380	Endoglucanase A OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=celA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.007319	0.576020	0.414431	0.001370	0.000486	0.000343

TMHMM  Annotations     

start	end
7	29