CAZyme Information: MGYG000004871_01414

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; CAG-485
• CAZyme ID: MGYG000004871_01414
• CAZy Family: GT26
• CAZyme Description: N-acetylglucosaminyldiphosphoundecaprenol N-acetyl-beta-D-mannosaminyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
246		28400.96	9.3861

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004871	2408616	MAG	Chile	South America

• Gene Location: Start: 30498; End: 31238 Strand: -

Full Sequence      

MKTYFNIRYEMERDEVHRAIERRLGAPGSDYICVADGVILNTANRRPDYLEVVNGGMFSI
CDSGFVPLYIKWIYGKRYEQYCGSQIFMDIVKSRKYRMIFLGAQQATLDGLRENMSAVNP
DVAEMKFVELPFRPVDAFDYEGIARLIEQDGAQIVWVALGAPKQEIFMSKLKPHLGHGVM
IAIGAAFKFYSGVETSRAPQWMVRNHLEFVHRIFKEPRKQVGRCWDIVRTLPGLLYGEWR
KSKTAR

Enzyme Prediction     

No EC number prediction in MGYG000004871_01414.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT26	58	219	2e-32	0.935672514619883

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06533	Glyco_transf_WecG_TagA	1.45e-40	53	223	1	170	The glycosyltransferase WecG/TagA superfamily contains Escherichia coli WecG, Bacillus subtilis TagA and related proteins. E. coli WecG is believed to be a UDP-N-acetyl-D-mannosaminuronic acid transferase, and is involved in enterobacterial common antigen (eca) synthesis. B. subtilis TagA plays a key role in the Wall Teichoic Acid (WTA) biosynthetic pathway, catalyzing the transfer of N-acetylmannosamine to the C4 hydroxyl of a membrane-anchored N-acetylglucosaminyl diphospholipid to make ManNAc-beta-(1,4)-GlcNAc-pp-undecaprenyl. This is the first committed step in this pathway. Also included in this group is Xanthomonas campestris pv. campestris GumM, a glycosyltransferase participating in the biosynthesis of the exopolysaccharide xanthan.
pfam03808	Glyco_tran_WecB	1.70e-39	60	223	5	168	Glycosyl transferase WecB/TagA/CpsF family.
COG1922	WecG	8.91e-24	14	244	23	253	UDP-N-acetyl-D-mannosaminuronic acid transferase, WecB/TagA/CpsF family [Cell wall/membrane/envelope biogenesis].
PRK03692	PRK03692	2.88e-08	143	221	150	229	putative UDP-N-acetyl-D-mannosaminuronic acid transferase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCP71494.1	3.69e-127	1	245	1	245
QUT18586.1	1.24e-121	1	246	1	245
BBK89734.1	1.53e-117	1	245	1	246
QUR49334.1	1.53e-117	1	245	1	246
QIX65917.1	1.53e-117	1	245	1	246

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7MPK_A	2.14e-11	32	217	35	219	ChainA, N-acetylglucosaminyldiphosphoundecaprenol N-acetyl-beta-D-mannosaminyltransferase [Thermoanaerobacter italicus Ab9],7MPK_B Chain B, N-acetylglucosaminyldiphosphoundecaprenol N-acetyl-beta-D-mannosaminyltransferase [Thermoanaerobacter italicus Ab9],7MPK_C Chain C, N-acetylglucosaminyldiphosphoundecaprenol N-acetyl-beta-D-mannosaminyltransferase [Thermoanaerobacter italicus Ab9],7N41_A Chain A, N-acetylglucosaminyldiphosphoundecaprenol N-acetyl-beta-D-mannosaminyltransferase [Thermoanaerobacter italicus Ab9],7N41_B Chain B, N-acetylglucosaminyldiphosphoundecaprenol N-acetyl-beta-D-mannosaminyltransferase [Thermoanaerobacter italicus Ab9],7N41_C Chain C, N-acetylglucosaminyldiphosphoundecaprenol N-acetyl-beta-D-mannosaminyltransferase [Thermoanaerobacter italicus Ab9]
5WB4_A	4.08e-08	32	192	35	195	Crystalstructure of the TarA wall teichoic acid glycosyltransferase [Thermoanaerobacter italicus Ab9],5WB4_B Crystal structure of the TarA wall teichoic acid glycosyltransferase [Thermoanaerobacter italicus Ab9],5WB4_C Crystal structure of the TarA wall teichoic acid glycosyltransferase [Thermoanaerobacter italicus Ab9],5WB4_D Crystal structure of the TarA wall teichoic acid glycosyltransferase [Thermoanaerobacter italicus Ab9],5WB4_E Crystal structure of the TarA wall teichoic acid glycosyltransferase [Thermoanaerobacter italicus Ab9],5WB4_F Crystal structure of the TarA wall teichoic acid glycosyltransferase [Thermoanaerobacter italicus Ab9],5WB4_G Crystal structure of the TarA wall teichoic acid glycosyltransferase [Thermoanaerobacter italicus Ab9],5WB4_H Crystal structure of the TarA wall teichoic acid glycosyltransferase [Thermoanaerobacter italicus Ab9]
5WFG_A	7.59e-08	32	192	35	195	Crystalstructure of the TarA wall teichoic acid glycosyltransferase bound to UDP [Thermoanaerobacter italicus Ab9],5WFG_B Crystal structure of the TarA wall teichoic acid glycosyltransferase bound to UDP [Thermoanaerobacter italicus Ab9],5WFG_C Crystal structure of the TarA wall teichoic acid glycosyltransferase bound to UDP [Thermoanaerobacter italicus Ab9],5WFG_D Crystal structure of the TarA wall teichoic acid glycosyltransferase bound to UDP [Thermoanaerobacter italicus Ab9],5WFG_E Crystal structure of the TarA wall teichoic acid glycosyltransferase bound to UDP [Thermoanaerobacter italicus Ab9],5WFG_F Crystal structure of the TarA wall teichoic acid glycosyltransferase bound to UDP [Thermoanaerobacter italicus Ab9]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P27620	6.30e-13	31	217	27	218	N-acetylglucosaminyldiphosphoundecaprenol N-acetyl-beta-D-mannosaminyltransferase OS=Bacillus subtilis (strain 168) OX=224308 GN=tagA PE=1 SV=1
Q8RKI7	7.16e-11	31	219	35	220	N-acetylglucosaminyldiphosphoundecaprenol N-acetyl-beta-D-mannosaminyltransferase OS=Bacillus spizizenii (strain ATCC 23059 / NRRL B-14472 / W23) OX=655816 GN=tarA PE=3 SV=1
B5QVI6	3.02e-06	147	239	156	240	UDP-N-acetyl-D-mannosaminuronic acid transferase OS=Salmonella enteritidis PT4 (strain P125109) OX=550537 GN=wecG PE=3 SV=1
B5FN88	3.02e-06	147	239	156	240	UDP-N-acetyl-D-mannosaminuronic acid transferase OS=Salmonella dublin (strain CT_02021853) OX=439851 GN=wecG PE=3 SV=1
B5RFQ9	3.02e-06	147	239	156	240	UDP-N-acetyl-D-mannosaminuronic acid transferase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) OX=550538 GN=wecG PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000052	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004871_01414.