CAZyme Information: MGYG000004884_00371

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; KLE1615
• CAZyme ID: MGYG000004884_00371
• CAZy Family: CE15
• CAZyme Description: Carbohydrate esterase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
362	MGYG000004884_22|CGC1	40755.14	6.0642

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004884	2896455	MAG	China	Asia

• Gene Location: Start: 13505; End: 14593 Strand: +

Full Sequence      

MKFLDEELKKRALPPLFLRDYGTNVTDPAGWEVRRKEIKDLLYREFYGYPCRFPTKTEGI
VMKQDPNAYGGKAYTDQVELRVTSPFAWFSFPCTVTLPKGADGEKHPVFVYLSFQPQTAD
GLGEEIIDSGYGIVNLYYQDVAADREDGFVSGVGRFCSRNPYDSWGKLAMWAWGAQRAVD
CLLTRTDIDPARIGVMGHSRLGKAALAAGMFDERFSITVSNDSGAGGAALFRQKKGEKIA
DMKNPGANCWFGRNLFAYADKEDQLPFDMHFLLALAAPRFLYVCSASEDDWADPESEYLS
CLAASPAYELYGLPGLIAPDRYPQAGDSFPEGRIGYHMRKGTHYLSRYDWQKVIAFRDRN
RV

Enzyme Prediction     

No EC number prediction in MGYG000004884_00371.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE15	13	359	8.7e-78	0.9776951672862454

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1506	DAP2	0.001	92	220	379	502	Dipeptidyl aminopeptidase/acylaminoacyl peptidase [Amino acid transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALL53565.1	5.19e-147	1	362	1	360
QOV20253.1	3.05e-141	1	357	1	355
AEE95892.1	6.95e-90	4	362	2	362
QNK58798.1	3.69e-77	12	360	7	370
QHT60959.1	3.45e-74	8	360	2	366

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6GRY_A	5.08e-65	12	356	13	391	GlucuronoylEsterase from Solibacter usitatus. [Candidatus Solibacter usitatus]
6GRW_A	5.95e-65	12	358	6	394	GlucuronoylEsterase from Opitutus terrae (Au derivative) [Opitutus terrae PB90-1],6GS0_A Native Glucuronoyl Esterase from Opitutus terrae [Opitutus terrae PB90-1]
6SYU_A	9.45e-65	12	358	24	412	Thewild type glucuronoyl esterase OtCE15A from Opitutus terrae in complex with xylobiose [Opitutus terrae],6T0I_A The wild type glucuronoyl esterase OtCE15A from Opitutus terrae in complex with the aldotetrauronic acid XUX [Opitutus terrae]
6SYR_A	1.41e-64	12	358	35	423	Thewild type glucuronoyl esterase OtCE15A from Opitutus terrae in complex with D-glucuronate [Opitutus terrae PB90-1]
6SYV_A	2.63e-64	12	358	24	412	Theglucuronoyl esterase OtCE15A S267A variant from Opitutus terrae in complex with D-glucuronate [Opitutus terrae PB90-1],6SZO_A The glucuronoyl esterase OtCE15A S267A variant from Opitutus terrae in complex with D-galacturonate [Opitutus terrae PB90-1],6T0E_A The glucuronoyl esterase OtCE15A S267A variant from Opitutus terrae in complex with benzyl D-glucuronoate and D-glucuronate [Opitutus terrae PB90-1],6T0E_B The glucuronoyl esterase OtCE15A S267A variant from Opitutus terrae in complex with benzyl D-glucuronoate and D-glucuronate [Opitutus terrae PB90-1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A0A0K2VM55	1.51e-52	5	358	34	424	Carbohydrate esterase MZ0003 OS=Unknown prokaryotic organism OX=2725 GN=MZ0003 PE=1 SV=1
D8QLP9	1.58e-31	12	314	35	326	4-O-methyl-glucuronoyl methylesterase OS=Schizophyllum commune (strain H4-8 / FGSC 9210) OX=578458 GN=SCHCODRAFT_238770 PE=1 SV=1
B2ABS0	6.47e-30	22	338	132	439	4-O-methyl-glucuronoyl methylesterase OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) OX=515849 GN=ge1 PE=1 SV=1
P0CU53	4.77e-29	13	314	45	340	4-O-methyl-glucuronoyl methylesterase 1 OS=Wolfiporia cocos (strain MD-104) OX=742152 GN=WOLCODRAFT_23632 PE=1 SV=1
Q7S1X0	3.26e-26	13	313	43	330	4-O-methyl-glucuronoyl methylesterase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=Cip2 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000087	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004884_00371.