CAZyme Information: MGYG000004884_02082

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; KLE1615
• CAZyme ID: MGYG000004884_02082
• CAZy Family: GH2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
877		100050.7	4.8145

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004884	2896455	MAG	China	Asia

• Gene Location: Start: 117; End: 2750 Strand: -

Full Sequence      

MIIELNSSWQMRQLPNTDALQVSGNSRCLNNLQSSCSAKSAGEFLPASVPGSVYSTLLAN
GLMEDPFFRANEEKALPLMNHDYEFVTRFDCPKELASCEHILLHFDGIDTLADIYLNGQH
LGFADNMHRIWEYDVTDILFSVENDLRLVFHSPTRFIAESYAEKPIQGCGEAMRGLSYLR
KAHCMFGWDWGPRLPDAGLFRPVRLIGVDTARIDSVLITQDHTPDAVTLTVSVEMDPGIP
VSDPVSGSSCQAVIHPASHRFGSTFSSASSPYGTDLLLDTLSYRVRITAPDGSVSEFENS
PKTLRIEHPQLWWPNGFGEQPLYTVCIELLDGPDDNPVILDVWERRIGLRTLTIRREKDE
YGESFAHEVNGVSIFAMGADYIPEDNILSRVTKERTRRLLQDAKAAHYNVIRVWGGGYYP
EDFFYDLCDELGLIVWQDFMFACCSYRLTDAFEANLTAEFIDNIKRLRHHASLGLWCGNN
EIETFIVGNRSYWCLDPAEYGDYIRLFEYILPKLTAAYSPQTFYWPASPSSGGSFDNPDD
ANRGDVHYWDVWHGNKPFTEYRKFFFRYVSEFGFQSFPSLKTVEQFTLPEDRNVFSYVME
RHQRNAAANGKIMNYMEQTFLYPSNFETLLYASQLLQAEAIRYGVEHFRRSRGRCMGSIV
WQLNDCWPVASWSSIDYYGRWKALHYYEKRFFAPLMISCQEEGTLTQDPNVNAQPYPLKK
SISLCVSNEQMSSADATVFWELRNADAKILRQESIPVTVAPLSSLWLDTVELPDADIYEN
YVSYRIEQNGTTISNGTVLFCAPKFFRFRNPKLSVRADGDLLTVSGSCYAKSVRIWNDAD
DLKLDDNYFDLSGGTRTVRILEGNPEGLRVMSVYDIR

Enzyme Prediction     

No EC number prediction in MGYG000004884_02082.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	3	768	1.3e-105	0.6875

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	2.54e-94	46	856	27	805	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
PRK10340	ebgA	3.35e-14	99	481	126	449	cryptic beta-D-galactosidase subunit alpha; Reviewed
pfam17786	Mannosidase_ig	2.09e-10	722	804	3	90	Mannosidase Ig/CBM-like domain. This domain corresponds to domain 4 in the structure of Bacteroides thetaiotaomicron beta-mannosidase, BtMan2A. This domain has an Ig-like fold.
pfam00703	Glyco_hydro_2	6.53e-07	211	350	1	106	Glycosyl hydrolases family 2. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
pfam17753	Ig_mannosidase	2.42e-06	810	875	1	78	Ig-fold domain. This Ig-like fold domain is found in mannosidase enzymes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEF82182.1	0.0	1	877	2	816
QBE97789.1	0.0	47	877	37	837
QIB54534.1	0.0	47	877	23	823
QMW79049.1	0.0	47	877	23	823
ADL35923.1	0.0	43	873	19	820

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6BYE_A	3.94e-158	41	860	29	832	Crystalstructure of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri in complex with mannose [Xanthomonas citri pv. citri str. 306],6BYE_B Crystal structure of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri in complex with mannose [Xanthomonas citri pv. citri str. 306]
6BYC_A	4.05e-158	41	860	29	832	Crystalstructure of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306]
6BYI_A	2.89e-157	41	860	27	830	Crystalstructure of the acid-base mutant (E477A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306],6BYI_B Crystal structure of the acid-base mutant (E477A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306]
6BYG_A	2.97e-157	41	860	29	832	Crystalstructure of the nucleophile mutant (E575A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306],6BYG_B Crystal structure of the nucleophile mutant (E575A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306]
2VJX_A	3.26e-147	43	856	24	811	Structuraland biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VJX_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VQT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VQT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VR4_A Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482],2VR4_B Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q4WAH4	1.47e-104	38	743	20	699	Beta-mannosidase B OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=mndB PE=3 SV=1
B0YBU9	5.52e-104	38	743	20	699	Beta-mannosidase B OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=mndB PE=3 SV=1
A1CGA8	2.89e-103	39	867	21	834	Beta-mannosidase B OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=mndB PE=3 SV=1
A1D911	5.61e-103	49	743	32	699	Beta-mannosidase B OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=mndB PE=3 SV=1
Q5B7W2	7.66e-101	48	702	31	663	Beta-mannosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=mndB PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000050	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004884_02082.