CAZyme Information: MGYG000004889_02088

Basic Information

• Species: UMGS1591 sp900553255
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; UMGS1591; UMGS1591 sp900553255
• CAZyme ID: MGYG000004889_02088
• CAZy Family: GH116
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
862		96917.05	4.815

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004889	2521508	MAG	China	Asia

• Gene Location: Start: 828; End: 3416 Strand: -

Full Sequence      

MSRTPDFVYTGEYTREISFPLGGIGTGCIGLGGNGRLMDWEIYNRPNKGSLNGMSHFAVK
AVQDGRLLDARVLTGDLDKDLAGQYGGGVGHWQCPGYGFGAESGTMAGFPHFSDCRFKGT
FPIAELTFTDSHFPGSVKMTAFNPFIPLDADASGMPAAFFEIELENPTAAPITYTVALSV
GNCFSQGTVNRGGRVDGISYICLEQNVLGEKEQHYGNITAATDGGDVCLQEHWFRGAWFD
GPTIFWKEFTDTAPLPARRYDPPGDRDMATLTASVTAAPGEQKTVRFIIAWYFPNNEYDW
PPIYAPAPGETLGGRWKNYYAGQYGSSVDVAVQGLRQWQSLYGRTRRFTDVLFSSTLPRE
ALDAVSANLAVLKSPTVWRLEDGTLYGFEGVSEHCGSCEGSCTHVWNYAYAMPFLFPQLE
RSMHSASYQYDFLENGRMSFRILLPLGKKPLPFHPCVDGQMGEIMRVYRDWKLCGDDDWL
KAIWPRVKQSLEYAWHPQNPYRWDADKDGVIDGRQHHTLDMELFGPNSWLEGFYLGALNA
AAEMAEYLGEADAAEDYRCLFENGRRFCNEKLFNGEYYEQKVDLHDKTLLESYGQDAVNA
YWNEETGEMKYQIDHGCSIDQMTAQWHANIIGLDDIFDKAKRKKALQSLYRYNFKACMRD
FFNPCRVFCTGDEAGAVICEYPDTAEKPAVPVPYCQECMTGFEYQLAALMISEGMQEEGL
RLVRAVRDRYDGKKRNPWNEVECGSNYARSMASYSLLPLYSGFRFDLPHGMIGFSPLYPT
NRPFRCLWSADSAWGSVDIVPEHATIRIEEGHLSLQRLELPCITGEVCITVDGEPVQANW
ENGAAFFADRIRAECEIVVSRK

Enzyme Prediction     

No EC number prediction in MGYG000004889_02088.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH116	457	756	1.2e-66	0.7272727272727273

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam12215	Glyco_hydr_116N	1.40e-52	19	341	2	309	beta-glucosidase 2, glycosyl-hydrolase family 116 N-term. This domain is found in bacteria, archaea and eukaryotes. This domain is typically between 320 to 354 amino acids in length. This domain is found associated with pfam04685. It is found just after the extreme N-terminus. The N-terminal is thought to be the luminal domain while the C terminal is the cytosolic domain. The catalytic domain of GBA-2 is unknown. The primary catabolic pathway for glucosylceramide is catalysis by the lysosomal enzyme glucocerebrosidase. In higher eukaryotes, glucosylceramide is the precursor of glycosphingolipids, a complex group of ubiquitous membrane lipids. Mutations in the human protein cause motor-neurone defects in hereditary spastic paraplegia. The catalytic nucleophile, identified in UniProtKB:Q97YG8_SULSO, is a glutamine-335 in the downstream family pfam04685.
pfam04685	DUF608	2.10e-49	398	756	6	362	Glycosyl-hydrolase family 116, catalytic region. This represents a family of archaeal, bacterial and eukaryotic glycosyl hydrolases, that belong to superfamily GH116. The primary catabolic pathway for glucosylceramide is catalysis by the lysosomal enzyme glucocerebrosidase. In higher eukaryotes, glucosylceramide is the precursor of glycosphingolipids, a complex group of ubiquitous membrane lipids. Mutations in the human protein cause motor-neurone defects in hereditary spastic paraplegia. The catalytic nucleophile, identified in UniProtKB:Q97YG8_SULSO, is a glutamine-335, with the likely acid/base at Asp-442 and the aspartates at Asp-406 and Asp-458 residues also playing a role in the catalysis of glucosides and xylosides that are beta-bound to hydrophobic groups. The family is defined as GH116, which presently includes enzymes with beta-glucosidase, EC:3.2.1.21, beta-xylosidase, EC:3.2.1.37, and glucocerebrosidase EC:3.2.1.45 activity.
COG4354	COG4354	9.11e-45	20	764	16	721	Uncharacterized protein, contains GBA2_N and DUF608 domains [Function unknown].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QHT59778.1	0.0	9	851	5	851
AZN43107.1	0.0	9	862	5	864
ANE45793.1	0.0	8	821	4	822
QGQ98288.1	2.32e-317	8	821	4	826
QHW31016.1	1.54e-315	8	849	4	850

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q5M868	9.49e-17	20	761	144	876	Non-lysosomal glucosylceramidase OS=Rattus norvegicus OX=10116 GN=Gba2 PE=2 SV=2
Q9HCG7	4.45e-15	3	761	134	885	Non-lysosomal glucosylceramidase OS=Homo sapiens OX=9606 GN=GBA2 PE=1 SV=2
Q7KT91	4.90e-11	6	721	105	893	Non-lysosomal glucosylceramidase OS=Drosophila melanogaster OX=7227 GN=CG33090 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000054	0.000002	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004889_02088.