CAZyme Information: MGYG000004899_03373

Basic Information

• Species: Bacteroides sp900555635
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides sp900555635
• CAZyme ID: MGYG000004899_03373
• CAZy Family: GH50
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
651		74487.68	5.7657

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004899	5396709	MAG	China	Asia

• Gene Location: Start: 76752; End: 78707 Strand: -

Full Sequence      

MKNKMRTVLLATLTASLFVQCTPTERTFKVQFDSTKEVSGKKFALKDINPELPSDWDEYK
FVVIEYKSTTAQRFHLGFTTDSGYNELRVMCYVPNAWNKLAIPLKYFTELPGAAVDLAAT
FNHARYMGWINLGGRRGPLQGVDSVGVRMRKPIRNPMIEIRSITLATEDPGDEYMGEVPA
VDEFGQSNLVEYEGKISSLEQLKKEWEAEDAEVVTTDAYNYSKFGGYKQQQVKATGFFRT
EKIGDRWWFVDPEGYLFLSVGVDCVSPGGGGTIRDVEHRKGMYKELPPAELMEKFARRSY
RGNNLASFGFWNQYRRYGDAFPEKSKELIFKRMDKWGLNTIANWSSSEVMNMNRKAFLIP
LRNIGIEHDLMGLCDVYDSAFKSKVDKSLSEFVAPYKNNPWLIGYFIGNEPAWLDEEARL
CGLILDGKDRPIKIALRKYLNEKGDTPENRKEFILSTFRIFLSTTNQILKKHDPNHLNLG
IRFGNILTLDEEILQMCGESFDVLSFNCYDLVPNPAMMDRALKIANLPMIIGEYHFGTVD
RGMAQSLWQVDSQEQRGVAYRYYTENAYSHPGLIGTGYFLWCDQDLTGRGDGENYNCGLI
DVTDRPYKEQVEAMMETAKLLYDIHSGTKQPTDRKPENARGHEAIPDLWNE

Enzyme Prediction     

No EC number prediction in MGYG000004899_03373.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH50	140	622	8.4e-92	0.8330781010719756

CDD Domains     

MGYG000004899_03373 has no CDD domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBE17136.1	0.0	25	650	48	666
AXP07832.1	0.0	26	651	25	645
SCM56829.1	0.0	5	649	1	644
AHF13634.1	8.89e-298	21	650	20	646
ASB49335.1	3.60e-268	29	651	27	646

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4BQ2_A	5.95e-56	48	629	56	750	Structuralanalysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ2_B Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ2_C Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ2_D Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ3_A Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ3_B Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ3_C Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ3_D Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40]
4BQ4_A	1.53e-55	48	629	56	750	Structuralanalysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ4_B Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ5_A Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ5_B Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40]
6XJ9_A	4.16e-54	30	623	61	760	Structureof PfGH50B [Pseudoalteromonas fuliginea],6XJ9_B Structure of PfGH50B [Pseudoalteromonas fuliginea]
5Z6P_A	2.42e-46	181	622	223	759	Thecrystal structure of an agarase, AgWH50C [Agarivorans gilvus],5Z6P_B The crystal structure of an agarase, AgWH50C [Agarivorans gilvus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P48840	2.70e-43	128	622	383	949	Beta-agarase B OS=Vibrio sp. (strain JT0107) OX=47913 GN=agaB PE=3 SV=1
P48839	2.42e-31	182	616	400	907	Beta-agarase A OS=Vibrio sp. (strain JT0107) OX=47913 GN=agaA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000048	0.016401	0.983572	0.000008	0.000013	0.000009

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004899_03373.