CAZyme Information: MGYG000004899_03766

Basic Information

• Species: Bacteroides sp900555635
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides sp900555635
• CAZyme ID: MGYG000004899_03766
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
504	MGYG000004899_30|CGC1	55589.26	5.9539

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004899	5396709	MAG	China	Asia

• Gene Location: Start: 18158; End: 19672 Strand: -

Full Sequence      

MALLLTVTALSCSSSNNTTEELSYLNLKSVSTKSLTANGGETIISVSSWPIATAQSNAEW
LTLKSTTSLDKLTSFVFTAQANEGDARETTITITAGEKKESVTISQAKNNKPENKPIDEN
LPAVKIAKELGLGWNLGNQLDAYANEVANETSWGNGLATQETFNKVKSAGFTSVRIPITW
LGKVGEAPEYLINSTWLDRVEELVGYAENAGLKTIINIHHDGYRHIHEDGRVESHWLDIV
KAAKDAAANNVIKAQIKAMWTQIAKRFKDKGDFLIFEGLNEIHDGKWGSTSNTTDSSTQY
DILNEWQQIFVDAVRATGGNNANRYLGISGYCTNPDLTMKHLKLPTDLTKDRLLVSVHYY
DPATFALEDKFAEWGHTGAVGKKESWGDENHLKDIFNALKVTYVEKGIPVYIGEMGCVHR
SNSRSEAFRKYYLEYVCKAARTYGMAVFYWDNGNAGSGRECSGLMNHATGIFVNNGKDIV
NAMAKGYFTDDASYTLETVYNSAP

Enzyme Prediction     

EC	3.2.1.4

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	149	453	1.3e-95	0.9927536231884058

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00150	Cellulase	3.61e-52	140	456	1	272	Cellulase (glycosyl hydrolase family 5).
COG2730	BglC	2.59e-23	126	454	47	361	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
cd14948	BACON	7.36e-14	29	107	5	83	Bacteroidetes-Associated Carbohydrate-binding (putative) Often N-terminal (BACON) domain. The BACON domain is found in diverse domain architectures and accociated with a wide variety of domains, including carbohydrate-active enzymes and proteases. It was named for its suggested function of carbohydrate binding; the latter was inferred from domain architectures, sequence conservation, and phyletic distribution. However, recent experimental data suggest that its primary function in Bacteroides ovatus endo-xyloglucanase BoGH5A is to distance the catalytic module from the cell surface and confer additional mobility to the catalytic domain for attack of the polysaccharide. No evidence for a direct role in carbohydrate binding could be found in that case. The large majority of BACON domains are found in Bacteroidetes.
pfam13004	BACON	1.84e-07	53	107	4	61	Putative binding domain, N-terminal. The BACON (Bacteroidetes-Associated Carbohydrate-binding Often N-terminal) domain is an all-beta domain found in diverse architectures, principally in combination with carbohydrate-active enzymes and proteases. These architectures suggest a carbohydrate-binding function which is also supported by the nature of BACON's few conserved amino-acids. The phyletic distribution of BACON and other data tentatively suggest that it may frequently function to bind mucin. Further work with the characterized structure of a member of glycoside hydrolase family 5 enzyme, Structure 3ZMR, has found no evidence for carbohydrate-binding for this domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT35080.1	2.51e-279	1	504	12	516
AVM57519.1	4.53e-277	1	504	58	562
ADD61911.1	2.43e-269	24	504	3	484
QRX62664.1	1.73e-250	9	504	21	512
1814455A	1.03e-243	1	457	11	467

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6WQY_A	6.20e-155	124	489	25	384	ChainA, Cellulase [Phocaeicola salanitronis DSM 18170]
4YHE_A	5.53e-131	115	504	1	385	NativeBacteroidetes-affiliated Gh5 Cellulase Linked With A Polysaccharide Utilization Locus [Bacteroidetes bacterium AC2a],4YHE_B Native Bacteroidetes-affiliated Gh5 Cellulase Linked With A Polysaccharide Utilization Locus [Bacteroidetes bacterium AC2a]
4YHG_A	4.45e-130	115	504	1	385	NativeBacteroidetes-affiliated Gh5 Cellulase Linked With A Polysaccharide Utilization Locus [Bacteroidetes bacterium AC2a],4YHG_B Native Bacteroidetes-affiliated Gh5 Cellulase Linked With A Polysaccharide Utilization Locus [Bacteroidetes bacterium AC2a]
2JEP_A	1.80e-83	123	486	35	393	Nativefamily 5 xyloglucanase from Paenibacillus pabuli [Paenibacillus pabuli],2JEP_B Native family 5 xyloglucanase from Paenibacillus pabuli [Paenibacillus pabuli],2JEQ_A Family 5 xyloglucanase from Paenibacillus pabuli in complex with ligand [Paenibacillus pabuli]
3NDY_A	3.93e-65	120	486	9	340	Thestructure of the catalytic and carbohydrate binding domain of endoglucanase D from Clostridium cellulovorans [Clostridium cellulovorans],3NDY_B The structure of the catalytic and carbohydrate binding domain of endoglucanase D from Clostridium cellulovorans [Clostridium cellulovorans],3NDY_C The structure of the catalytic and carbohydrate binding domain of endoglucanase D from Clostridium cellulovorans [Clostridium cellulovorans],3NDY_D The structure of the catalytic and carbohydrate binding domain of endoglucanase D from Clostridium cellulovorans [Clostridium cellulovorans],3NDZ_A The structure of the catalytic and carbohydrate binding domain of endoglucanase D from Clostridium cellulovorans bound to cellotriose [Clostridium cellulovorans],3NDZ_B The structure of the catalytic and carbohydrate binding domain of endoglucanase D from Clostridium cellulovorans bound to cellotriose [Clostridium cellulovorans],3NDZ_C The structure of the catalytic and carbohydrate binding domain of endoglucanase D from Clostridium cellulovorans bound to cellotriose [Clostridium cellulovorans],3NDZ_D The structure of the catalytic and carbohydrate binding domain of endoglucanase D from Clostridium cellulovorans bound to cellotriose [Clostridium cellulovorans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O08342	1.82e-77	120	486	37	398	Endoglucanase A OS=Paenibacillus barcinonensis OX=198119 GN=celA PE=1 SV=1
P28623	8.15e-63	120	486	40	371	Endoglucanase D OS=Clostridium cellulovorans (strain ATCC 35296 / DSM 3052 / OCM 3 / 743B) OX=573061 GN=engD PE=1 SV=2
Q12647	3.67e-59	119	486	21	362	Endoglucanase B OS=Neocallimastix patriciarum OX=4758 GN=CELB PE=2 SV=1
P28621	1.26e-58	120	460	39	348	Endoglucanase B OS=Clostridium cellulovorans (strain ATCC 35296 / DSM 3052 / OCM 3 / 743B) OX=573061 GN=engB PE=3 SV=1
P23660	1.77e-53	120	469	24	347	Endoglucanase A OS=Ruminococcus albus OX=1264 GN=celA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.209404	0.241290	0.548791	0.000191	0.000149	0.000176

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004899_03766.