Basic Information | |
---|---|
Species | Ricinus communis |
Cazyme ID | 30015.m000220 |
Family | AA2 |
Protein Properties | Length: 184 Molecular Weight: 19122.9 Isoelectric Point: 8.3803 |
Chromosome | Chromosome/Scaffold: 30015 Start: 123032 End: 125510 |
Description | Peroxidase superfamily protein |
View CDS |
External Links |
---|
NCBI Taxonomy |
Plaza |
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
AA2 | 57 | 154 | 2.3e-32 |
STEARMGASLLRLHFHDCFGCDASVLLDGASGEKSAPANTNSIRGFEVIDSIKTQLETSCPGVVSCADILAVAARDSVVALGGPNWNVQLGRRDSATA |
Full Sequence |
---|
Protein Sequence Length: 184 Download |
MASFQSFSSP LAFKFQLGII SLYLVGIASA QLSPTFYATA CPNALSIIKS GVTAAVSTEA 60 RMGASLLRLH FHDCFGCDAS VLLDGASGEK SAPANTNSIR GFEVIDSIKT QLETSCPGVV 120 SCADILAVAA RDSVVALGGP NWNVQLGRRD SATANFAKAM VKMGNLSPLT GTNGQIRTNC 180 RTAN |
Functional Domains Download unfiltered results here | ||||||
---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description |
PLN03030 | PLN03030 | 0.004 | 134 | 184 | 51 | + cationic peroxidase; Provisional |
cd00693 | secretory_peroxidase | 2.0e-10 | 156 | 181 | 26 | + Horseradish peroxidase and related secretory plant peroxidases. Secretory peroxidases belong to class III of the plant heme-dependent peroxidase superfamily. All members of the superfamily share a heme prosthetic group and catalyze a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. Class III peroxidases are found in the extracellular space or in the vacuole in plants where they have been implicated in hydrogen peroxide detoxification, auxin catabolism and lignin biosynthesis, and stress response. Class III peroxidases contain four conserved disulphide bridges and two conserved calcium binding sites. |
PLN03030 | PLN03030 | 5.0e-41 | 36 | 150 | 117 | + cationic peroxidase; Provisional |
pfam00141 | peroxidase | 4.0e-46 | 48 | 157 | 112 | + Peroxidase. |
cd00693 | secretory_peroxidase | 3.0e-71 | 31 | 155 | 130 | + Horseradish peroxidase and related secretory plant peroxidases. Secretory peroxidases belong to class III of the plant heme-dependent peroxidase superfamily. All members of the superfamily share a heme prosthetic group and catalyze a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. Class III peroxidases are found in the extracellular space or in the vacuole in plants where they have been implicated in hydrogen peroxide detoxification, auxin catabolism and lignin biosynthesis, and stress response. Class III peroxidases contain four conserved disulphide bridges and two conserved calcium binding sites. |
Gene Ontology | |
---|---|
GO Term | Description |
GO:0004601 | peroxidase activity |
GO:0006979 | response to oxidative stress |
GO:0020037 | heme binding |
GO:0055114 | oxidation-reduction process |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
Swiss-Prot | P22195 | 0 | 19 | 159 | 11 | 156 | PER1_ARAHY RecName: Full=Cationic peroxidase 1; AltName: Full=PNPC1; Flags: Precursor |
Swiss-Prot | P22195 | 0.0000009 | 155 | 184 | 287 | 316 | PER1_ARAHY RecName: Full=Cationic peroxidase 1; AltName: Full=PNPC1; Flags: Precursor |
RefSeq | XP_002323054.1 | 0 | 1 | 154 | 1 | 154 | predicted protein [Populus trichocarpa] |
RefSeq | XP_002323054.1 | 0.00000001 | 155 | 184 | 288 | 317 | predicted protein [Populus trichocarpa] |
RefSeq | XP_002531317.1 | 0 | 1 | 184 | 1 | 184 | peroxidase, putative [Ricinus communis] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 1sch_B | 0 | 31 | 159 | 1 | 134 | A Chain A, Peanut Peroxidase |
PDB | 1sch_B | 0.00000001 | 155 | 184 | 265 | 294 | A Chain A, Peanut Peroxidase |
PDB | 1sch_A | 0 | 31 | 159 | 1 | 134 | A Chain A, Peanut Peroxidase |
PDB | 1sch_A | 0.00000001 | 155 | 184 | 265 | 294 | A Chain A, Peanut Peroxidase |
PDB | 1qgj_B | 0 | 31 | 155 | 1 | 127 | A Chain A, Arabidopsis Thaliana Peroxidase N |