y PlantCAZyme

CAZyme Information

Basic Information
SpeciesRicinus communis
Cazyme ID31160.m000032
FamilyGT26
Protein PropertiesLength: 254 Molecular Weight: 28676.6 Isoelectric Point: 10.8224
ChromosomeChromosome/Scaffold: 31160 Start: 331 End: 1095
Description
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT26642245.19882e-43
  ESDVLLRDGVGVSILLSLLGVHPGINMNGTDLIPKMLNQSSGRVALMGTRDPYLSIAADKLASSGVSIALKLDGFLPDHCYVNAVLSGKPDVVILAMGMP
  KQERIALALKDAVNWPCLIINGGAILDFISGRVTRAPNVVQSLRLEWLFRLAQEPKRLFRR
Full Sequence
Protein Sequence     Length: 254     Download
MAYRYHMRGS SVIRKLTLVK SEWEYERILE SMRQVQRPVV VSFLNAHAFN LAWQETNYRR    60
SLVESDVLLR DGVGVSILLS LLGVHPGINM NGTDLIPKML NQSSGRVALM GTRDPYLSIA    120
ADKLASSGVS IALKLDGFLP DHCYVNAVLS GKPDVVILAM GMPKQERIAL ALKDAVNWPC    180
LIINGGAILD FISGRVTRAP NVVQSLRLEW LFRLAQEPKR LFRRYVLGNS VFLFRALRIS    240
RSFRRVRQEQ QALI                                                      300
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PRK03692PRK036921.0e-815522775+
TIGR00696wecG_tagA_cpsF2.0e-1392229149+
COG1922WecG6.0e-2936242217+
pfam03808Glyco_tran_WecB3.0e-3660224173+
cd06533Glyco_transf_WecG_TagA2.0e-3762225172+
Gene Ontology
GO TermDescription
GO:0009058biosynthetic process
Hydropathy