Basic Information | |
---|---|
Species | Ricinus communis |
Cazyme ID | 32526.m000035 |
Family | GH24 |
Protein Properties | Length: 148 Molecular Weight: 16600.8 Isoelectric Point: 5.1567 |
Chromosome | Chromosome/Scaffold: 32526 Start: 96 End: 542 |
Description | |
View CDS |
External Links |
---|
NCBI Taxonomy |
Plaza |
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
GH24 | 8 | 140 | 2.5e-24 |
QLIEELRRDEGVRYVPYLDTKGIQTTAVGHNLQASPLPAGWTYPLTDAQVDTLLHADLQNVYSDLNRDLPWWTDLNDVRQRVICNMCFNLGMSKLAGFKN TLAAMRQGAYADAARGMLNSAWASQVGDRAQRL |
Full Sequence |
---|
Protein Sequence Length: 148 Download |
MNPENEAQLI EELRRDEGVR YVPYLDTKGI QTTAVGHNLQ ASPLPAGWTY PLTDAQVDTL 60 LHADLQNVYS DLNRDLPWWT DLNDVRQRVI CNMCFNLGMS KLAGFKNTLA AMRQGAYADA 120 ARGMLNSAWA SQVGDRAQRL AQMMRTGE |
Functional Domains Download unfiltered results here | ||||||
---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description |
COG3772 | COG3772 | 3.0e-5 | 1 | 121 | 124 | + Phage-related lysozyme (muraminidase) [General function prediction only] |
cd00737 | endolysin_autolysin | 8.0e-10 | 3 | 121 | 119 | + Endolysins and autolysins are found in viruses and bacteria, respectively. The ds DNA phages of eubacteria use endolysins or muralytic enzymes in conjunction with hollin, a small membrane protein, to degrade the peptidoglycan found in bacterial cell walls. Similarly, bacteria produce autolysins to facilitate the biosynthesis of its cell wall hetropolymer peptidoglycan and cell division. Both endolysin and autolysin enzymes cleave the glycosidic beta 1,4-bonds between the N-acetylmuramic acid and the N-acetylglucosamine of the peptidoglycan. |
cd00735 | bacteriophage_T4-like_lysozyme | 4.0e-23 | 11 | 147 | 155 | + Bacteriophage T4-like lysozymes hydrolyse the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetylglucosamine (GlcNAc) in peptidoglycan heteropolymers of prokaryotic cell walls. Members include a variety of bacteriophages (T4, RB49, RB69, Aeh1) as well as Dictyostelium. |
PHA02596 | 5 | 2.0e-24 | 10 | 147 | 160 | + baseplate hub subunit and tail lysozyme; Provisional |
Gene Ontology | |
---|---|
GO Term | Description |
GO:0003796 | lysozyme activity |
GO:0009253 | peptidoglycan catabolic process |
GO:0016998 | cell wall macromolecule catabolic process |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
RefSeq | XP_002536359.1 | 0 | 1 | 148 | 1 | 148 | Lysozyme, putative [Ricinus communis] |
RefSeq | YP_002911073.1 | 1e-37 | 1 | 147 | 1 | 138 | hypothetical protein bglu_1g12050 [Burkholderia glumae BGR1] |
RefSeq | ZP_03572570.1 | 7e-31 | 1 | 147 | 1 | 138 | phage lysozyme [Burkholderia multivorans CGD2M] |
RefSeq | ZP_03574553.1 | 2e-29 | 1 | 147 | 1 | 138 | phage lysozyme [Burkholderia multivorans CGD2M] |
RefSeq | ZP_03586911.1 | 4e-30 | 1 | 147 | 1 | 138 | phage lysozyme [Burkholderia multivorans CGD1] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 1lwk_A | 9e-18 | 9 | 147 | 3 | 156 | A Chain A, Multiple Methionine Substitutions Are Tolerated In T4 Lysozyme And Have Coupled Effects On Folding And Stability |
PDB | 1cx7_A | 7e-17 | 9 | 147 | 3 | 156 | A Chain A, T4 Lysozyme Methionine Core Mutant |
PDB | 1cx6_A | 7e-17 | 9 | 147 | 3 | 156 | A Chain A, T4 Lysozyme Substituted With Selenomethionine |
PDB | 1lpy_A | 9e-17 | 9 | 147 | 3 | 156 | A Chain A, Multiple Methionine Substitutions In T4 Lysozyme |
PDB | 1l22_A | 1e-16 | 9 | 147 | 3 | 156 | A Chain A, Contributions Of Left-Handed Helical Residues To The Structure And Stability Of Bacteriophage T4 Lysozyme |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
DR040290 | 144 | 17 | 147 | 0.000006 |
EC155673 | 148 | 13 | 147 | 0.00001 |
EC161282 | 41 | 101 | 141 | 7.5 |