y PlantCAZyme

CAZyme Information

Basic Information
SpeciesRicinus communis
Cazyme ID32526.m000035
FamilyGH24
Protein PropertiesLength: 148 Molecular Weight: 16600.8 Isoelectric Point: 5.1567
ChromosomeChromosome/Scaffold: 32526 Start: 96 End: 542
Description
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH2481402.5e-24
  QLIEELRRDEGVRYVPYLDTKGIQTTAVGHNLQASPLPAGWTYPLTDAQVDTLLHADLQNVYSDLNRDLPWWTDLNDVRQRVICNMCFNLGMSKLAGFKN
  TLAAMRQGAYADAARGMLNSAWASQVGDRAQRL
Full Sequence
Protein Sequence     Length: 148     Download
MNPENEAQLI EELRRDEGVR YVPYLDTKGI QTTAVGHNLQ ASPLPAGWTY PLTDAQVDTL    60
LHADLQNVYS DLNRDLPWWT DLNDVRQRVI CNMCFNLGMS KLAGFKNTLA AMRQGAYADA    120
ARGMLNSAWA SQVGDRAQRL AQMMRTGE                                       180
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
COG3772COG37723.0e-51121124+
cd00737endolysin_autolysin8.0e-103121119+
cd00735bacteriophage_T4-like_lysozyme4.0e-2311147155+
PHA0259652.0e-2410147160+
Gene Ontology
GO TermDescription
GO:0003796lysozyme activity
GO:0009253peptidoglycan catabolic process
GO:0016998cell wall macromolecule catabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
RefSeqXP_002536359.1011481148Lysozyme, putative [Ricinus communis]
RefSeqYP_002911073.11e-3711471138hypothetical protein bglu_1g12050 [Burkholderia glumae BGR1]
RefSeqZP_03572570.17e-3111471138phage lysozyme [Burkholderia multivorans CGD2M]
RefSeqZP_03574553.12e-2911471138phage lysozyme [Burkholderia multivorans CGD2M]
RefSeqZP_03586911.14e-3011471138phage lysozyme [Burkholderia multivorans CGD1]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1lwk_A9e-1891473156A Chain A, Multiple Methionine Substitutions Are Tolerated In T4 Lysozyme And Have Coupled Effects On Folding And Stability
PDB1cx7_A7e-1791473156A Chain A, T4 Lysozyme Methionine Core Mutant
PDB1cx6_A7e-1791473156A Chain A, T4 Lysozyme Substituted With Selenomethionine
PDB1lpy_A9e-1791473156A Chain A, Multiple Methionine Substitutions In T4 Lysozyme
PDB1l22_A1e-1691473156A Chain A, Contributions Of Left-Handed Helical Residues To The Structure And Stability Of Bacteriophage T4 Lysozyme
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
DR040290144171470.000006
EC155673148131470.00001
EC161282411011417.5