Basic Information | |
---|---|
Species | Ricinus communis |
Cazyme ID | 53704.m000024 |
Family | GH23 |
Protein Properties | Length: 143 Molecular Weight: 15664.9 Isoelectric Point: 8.9283 |
Chromosome | Chromosome/Scaffold: 53704 Start: 27 End: 458 |
Description | |
View CDS |
External Links |
---|
NCBI Taxonomy |
Plaza |
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
GH23 | 35 | 123 | 1.4e-22 |
VSSQLVHAIAQQESGMRANAMNVNRDGSEDIGLMQINSSWLPKLARYGVRRDHLFNACVNAYVGAWILASNIRQFGPTWKAVGAYNAVS |
Full Sequence |
---|
Protein Sequence Length: 143 Download |
MMNVTFVVAA AITGMCCVSA AQADCLDDAA AYQHVSSQLV HAIAQQESGM RANAMNVNRD 60 GSEDIGLMQI NSSWLPKLAR YGVRRDHLFN ACVNAYVGAW ILASNIRQFG PTWKAVGAYN 120 AVSSQKQLIY ANAIYRRLQR QGH |
Functional Domains Download unfiltered results here | ||||||
---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description |
COG0741 | MltE | 8.0e-10 | 32 | 142 | 116 | + Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell envelope biogenesis, outer membrane] |
cd00254 | LT_GEWL | 6.0e-16 | 39 | 121 | 85 | + Lytic Transglycosylase (LT) and Goose Egg White Lysozyme (GEWL) domain. Members include the soluble and insoluble membrane-bound LTs in bacteria, the LTs in bacteriophage lambda, as well as, the eukaryotic "goose-type" lysozymes (GEWL). LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. |
PRK13722 | PRK13722 | 6.0e-19 | 35 | 136 | 109 | + lytic transglycosylase; Provisional |
pfam01464 | SLT | 3.0e-19 | 34 | 137 | 110 | + Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems. |
PRK15328 | PRK15328 | 5.0e-29 | 32 | 140 | 114 | + invasion protein IagB; Provisional |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
RefSeq | XP_002538823.1 | 0 | 1 | 143 | 1 | 143 | Invasion protein iagB precursor, putative [Ricinus communis] |
RefSeq | YP_001109725.1 | 0 | 2 | 142 | 1 | 139 | lytic transglycosylase, catalytic [Burkholderia vietnamiensis G4] |
RefSeq | YP_001585512.1 | 0 | 1 | 143 | 1 | 141 | lytic transglycosylase catalytic [Burkholderia multivorans ATCC 17616] |
RefSeq | ZP_02907892.1 | 0 | 8 | 142 | 7 | 140 | Lytic transglycosylase catalytic [Burkholderia ambifaria MEX-5] |
RefSeq | ZP_06228706.1 | 0 | 2 | 143 | 6 | 145 | lytic transglycosylase [Burkholderia sp. CCGE1002] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 3zvq_A | 0.008 | 44 | 80 | 32 | 68 | B Chain B, Crystal Structure Of Proteolyzed Lysozyme |
PDB | 1flu_A | 0.008 | 44 | 80 | 32 | 68 | A Chain A, Hen Egg White Lysozyme Mutant With Alanine Substituted For Glycine |
PDB | 1jug_A | 0.009 | 31 | 72 | 19 | 60 | A Chain A, Lysozyme From Echidna Milk (Tachyglossus Aculeatus) |
PDB | 1lsm_A | 0.01 | 44 | 80 | 32 | 68 | A Chain A, Thermal Stability Determinants Of Chicken Egg-White Lysozyme Core Mutants: Hydrophobicity, Packing Volume And Conserved Buried Water Molecu |
Signal Peptide | ||||
---|---|---|---|---|
Cleavage Site | ||||
23 |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
HS326472 | 37 | 36 | 72 | 0.001 |
BJ868956 | 40 | 32 | 71 | 0.37 |