| Basic Information | |
|---|---|
| Species | Ricinus communis |
| Cazyme ID | 60626.m00001 |
| Family | CBM13 |
| Protein Properties | Length: 148 Molecular Weight: 16390.5 Isoelectric Point: 4.6883 |
| Chromosome | Chromosome/Scaffold: 60626 Start: 2 End: 448 |
| Description | |
| View CDS | |
| External Links |
|---|
| NCBI Taxonomy |
| Plaza |
| CAZyDB |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
 | |||
| Family | Start | End | Evalue |
| CBM13 | 33 | 144 | 9.6e-25 |
| LYGLCLQANSGQVWIEDCSSEKAEQQWALYADGSIRPQQNRDNCLTSDSNIRETVVKILSCGPASSGQRWMFKNDGTILNLYSGLVLDVRASDPSLKQII LYPLHGDPNQIW | |||
| Full Sequence |
|---|
| Protein Sequence Length: 148 Download |
| GTTLTVQTNI YAVSQGWLPT NNTQPFVTTI VGLYGLCLQA NSGQVWIEDC SSEKAEQQWA 60 LYADGSIRPQ QNRDNCLTSD SNIRETVVKI LSCGPASSGQ RWMFKNDGTI LNLYSGLVLD 120 VRASDPSLKQ IILYPLHGDP NQIWLPLF |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
 | ||||||||
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| pfam14200 | RicinB_lectin_2 | 0.002 | 78 | 144 | 72 | + Ricin-type beta-trefoil lectin domain-like. | ||
| cd00161 | RICIN | 8.0e-7 | 65 | 144 | 81 | + Ricin-type beta-trefoil; Carbohydrate-binding domain formed from presumed gene triplication. The domain is found in a variety of molecules serving diverse functions such as enzymatic activity, inhibitory toxicity and signal transduction. Highly specific ligand binding occurs on exposed surfaces of the compact domain sturcture. | ||
| smart00458 | RICIN | 4.0e-25 | 29 | 144 | 118 | + Ricin-type beta-trefoil. Carbohydrate-binding domain formed from presumed gene triplication. | ||
| pfam00652 | Ricin_B_lectin | 1.0e-27 | 25 | 144 | 125 | + Ricin-type beta-trefoil lectin domain. | ||
| cd00161 | RICIN | 2.0e-29 | 29 | 145 | 121 | + Ricin-type beta-trefoil; Carbohydrate-binding domain formed from presumed gene triplication. The domain is found in a variety of molecules serving diverse functions such as enzymatic activity, inhibitory toxicity and signal transduction. Highly specific ligand binding occurs on exposed surfaces of the compact domain sturcture. | ||
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PRF/SEQDB | 0 | 1 | 148 | 115 | 262 | UP10_LACSN Unknown protein 10 from 2D-PAGE | |
| PDB | 2AAI | 0 | 1 | 148 | 115 | 262 | B Chain B, Crystallographic Refinement Of Ricin To 2.5 Angstroms |
| RefSeq | XP_002534655.1 | 0 | 1 | 148 | 40 | 187 | ricin homolog, truncated [Ricinus communis] |
| RefSeq | XP_002535765.1 | 0 | 1 | 148 | 1 | 148 | ricin homolog, truncated [Ricinus communis] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 3rtj_B | 0 | 1 | 148 | 115 | 262 | A Chain A, Crystal Structure Of A Beta-Galactosidase From Bacteroides Thetaiotaomicron |
| PDB | 3rtj_B | 0.0002 | 27 | 146 | 10 | 133 | A Chain A, Crystal Structure Of A Beta-Galactosidase From Bacteroides Thetaiotaomicron |
| PDB | 3rti_B | 0 | 1 | 148 | 115 | 262 | A Chain A, Crystal Structure Of A Beta-Galactosidase From Bacteroides Thetaiotaomicron |
| PDB | 3rti_B | 0.0002 | 27 | 146 | 10 | 133 | A Chain A, Crystal Structure Of A Beta-Galactosidase From Bacteroides Thetaiotaomicron |
| PDB | 2aai_B | 0 | 1 | 148 | 115 | 262 | B Chain B, Crystallographic Refinement Of Ricin To 2.5 Angstroms |
| Hydropathy |
|---|
 |
| EST Download unfiltered results here | ||||
|---|---|---|---|---|
 | ||||
| Hit | Length | Start | End | EValue |
| EV520571 | 104 | 2 | 105 | 0 |
| EV520571 | 36 | 108 | 143 | 0 |
| EL691180 | 148 | 1 | 148 | 0 |
| EV521769 | 92 | 1 | 92 | 0 |
| EL691180 | 76 | 51 | 125 | 0.71 |
| Sequence Alignments (This image is cropped. Click for full image.) |
|---|
 |
| Phylogeny |
|---|
 |