| Basic Information | |
|---|---|
| Species | Ricinus communis |
| Cazyme ID | 60639.m00003 |
| Family | CBM13 |
| Protein Properties | Length: 187 Molecular Weight: 20601.2 Isoelectric Point: 4.576 |
| Chromosome | Chromosome/Scaffold: 60639 Start: 177 End: 740 |
| Description | |
| View CDS | |
| External Links |
|---|
| NCBI Taxonomy |
| Plaza |
| CAZyDB |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
 | |||
| Family | Start | End | Evalue |
| CBM13 | 73 | 183 | 2.1e-24 |
| YGLCLQANSGQVWIEDCSSEKAEQQWALYADGSIRPQQNRDNCLTSDSNIRETVVKILSCGPASSGQRWMFKNDGTILNLYSGLVLDVRASDPSLKQIIL YPLHGDPNQIW | |||
| Full Sequence |
|---|
| Protein Sequence Length: 187 Download |
| MIYDCNTAAT DATRWQIWDN GTIINPRSSL VLAATSGNSG TTLTVQTNIY AVSQGWLPTN 60 NTQPFVTTIV GLYGLCLQAN SGQVWIEDCS SEKAEQQWAL YADGSIRPQQ NRDNCLTSDS 120 NIRETVVKIL SCGPASSGQR WMFKNDGTIL NLYSGLVLDV RASDPSLKQI ILYPLHGDPN 180 QIWLPLF |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
 | ||||||||
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| cd00161 | RICIN | 2.0e-6 | 104 | 183 | 81 | + Ricin-type beta-trefoil; Carbohydrate-binding domain formed from presumed gene triplication. The domain is found in a variety of molecules serving diverse functions such as enzymatic activity, inhibitory toxicity and signal transduction. Highly specific ligand binding occurs on exposed surfaces of the compact domain sturcture. | ||
| cd00161 | RICIN | 8.0e-7 | 1 | 57 | 58 | + Ricin-type beta-trefoil; Carbohydrate-binding domain formed from presumed gene triplication. The domain is found in a variety of molecules serving diverse functions such as enzymatic activity, inhibitory toxicity and signal transduction. Highly specific ligand binding occurs on exposed surfaces of the compact domain sturcture. | ||
| pfam00652 | Ricin_B_lectin | 3.0e-7 | 1 | 56 | 56 | + Ricin-type beta-trefoil lectin domain. | ||
| pfam00652 | Ricin_B_lectin | 9.0e-27 | 64 | 183 | 125 | + Ricin-type beta-trefoil lectin domain. | ||
| cd00161 | RICIN | 2.0e-28 | 68 | 184 | 121 | + Ricin-type beta-trefoil; Carbohydrate-binding domain formed from presumed gene triplication. The domain is found in a variety of molecules serving diverse functions such as enzymatic activity, inhibitory toxicity and signal transduction. Highly specific ligand binding occurs on exposed surfaces of the compact domain sturcture. | ||
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PRF/SEQDB | 0 | 1 | 187 | 76 | 262 | UP10_LACSN Unknown protein 10 from 2D-PAGE | |
| PDB | 2AAI | 0 | 1 | 187 | 76 | 262 | B Chain B, Crystallographic Refinement Of Ricin To 2.5 Angstroms |
| GenBank | AAB22582.1 | 0 | 1 | 187 | 355 | 541 | proricin A chain [Ricinus communis] |
| RefSeq | XP_002534649.1 | 0 | 1 | 187 | 390 | 576 | Ricin precursor [Ricinus communis] |
| RefSeq | XP_002534655.1 | 0 | 1 | 187 | 1 | 187 | ricin homolog, truncated [Ricinus communis] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 3rtj_B | 0 | 1 | 187 | 76 | 262 | B Chain B, Crystallographic Refinement Of Ricin To 2.5 Angstroms |
| PDB | 3rti_B | 0 | 1 | 187 | 76 | 262 | B Chain B, Crystallographic Refinement Of Ricin To 2.5 Angstroms |
| PDB | 2aai_B | 0 | 1 | 187 | 76 | 262 | B Chain B, Crystallographic Refinement Of Ricin To 2.5 Angstroms |
| PDB | 1rzo_D | 0 | 1 | 187 | 76 | 262 | B Chain B, Agglutinin From Ricinus Communis With Galactoaza |
| PDB | 1rzo_D | 0.0003 | 66 | 185 | 10 | 133 | B Chain B, Agglutinin From Ricinus Communis With Galactoaza |
| Hydropathy |
|---|
 |
| EST Download unfiltered results here | ||||
|---|---|---|---|---|
 | ||||
| Hit | Length | Start | End | EValue |
| EL691180 | 187 | 1 | 187 | 0 |
| EV521769 | 131 | 1 | 131 | 0 |
| EG699849 | 134 | 1 | 134 | 0 |
| EV521769 | 133 | 63 | 185 | 0.24 |
| EL691180 | 76 | 90 | 164 | 1.9 |
| Sequence Alignments (This image is cropped. Click for full image.) |
|---|
 |
| Phylogeny |
|---|
 |