| Basic Information | |
|---|---|
| Species | Aquilegia coerulea |
| Cazyme ID | Aquca_035_00200.1 |
| Family | GH17 |
| Protein Properties | Length: 152 Molecular Weight: 16680.3 Isoelectric Point: 10.4641 |
| Chromosome | Chromosome/Scaffold: 35 Start: 1882074 End: 1882648 |
| Description | O-Glycosyl hydrolases family 17 protein |
| View CDS | |
| External Links |
|---|
| CAZyDB |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
 | |||
| Family | Start | End | Evalue |
| GH17 | 22 | 151 | 1.4013e-45 |
| VNYGRIANNLPSAAKAVQLLKSQGIDQVKLYDTDQAVLKALSGSNMKVTVALPNELLNSVSKKKSFAFKWVQKNILSYYPSTQIQAIAVGNEVFVDPNNT TLFLVPAMQNIHSALINLNLHSIIKVSSPI | |||
| Full Sequence |
|---|
| Protein Sequence Length: 152 Download |
| MDRNYLNVTG PNRTKYNRSG FVNYGRIANN LPSAAKAVQL LKSQGIDQVK LYDTDQAVLK 60 ALSGSNMKVT VALPNELLNS VSKKKSFAFK WVQKNILSYY PSTQIQAIAV GNEVFVDPNN 120 TTLFLVPAMQ NIHSALINLN LHSIIKVSSP I* |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
 | ||||||||
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| pfam00332 | Glyco_hydro_17 | 4.0e-38 | 22 | 151 | 130 | + Glycosyl hydrolases family 17. | ||
| Gene Ontology | |
|---|---|
| GO Term | Description |
| GO:0004553 | hydrolase activity, hydrolyzing O-glycosyl compounds |
| GO:0005975 | carbohydrate metabolic process |
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| RefSeq | XP_002274828.1 | 0 | 22 | 151 | 26 | 155 | PREDICTED: hypothetical protein [Vitis vinifera] |
| RefSeq | XP_002302861.1 | 0 | 22 | 151 | 26 | 155 | predicted protein [Populus trichocarpa] |
| RefSeq | XP_002333242.1 | 0 | 22 | 151 | 26 | 155 | predicted protein [Populus trichocarpa] |
| RefSeq | XP_002338479.1 | 0 | 22 | 151 | 25 | 154 | predicted protein [Populus trichocarpa] |
| RefSeq | XP_002525335.1 | 0 | 22 | 151 | 26 | 155 | Glucan endo-1,3-beta-glucosidase precursor, putative [Ricinus communis] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 2cyg_A | 1e-24 | 22 | 151 | 3 | 131 | A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome |
| PDB | 3f55_D | 2e-23 | 22 | 151 | 4 | 135 | A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome |
| PDB | 3f55_C | 2e-23 | 22 | 151 | 4 | 135 | A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome |
| PDB | 3f55_B | 2e-23 | 22 | 151 | 4 | 135 | A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome |
| PDB | 3f55_A | 2e-23 | 22 | 151 | 4 | 135 | A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome |
| Hydropathy |
|---|
 |
| EST Download unfiltered results here | ||||
|---|---|---|---|---|
 | ||||
| Hit | Length | Start | End | EValue |
| JZ003118 | 130 | 22 | 151 | 0 |
| DT749026 | 130 | 22 | 151 | 0 |
| JZ014857 | 130 | 22 | 151 | 0 |
| DR920721 | 130 | 22 | 151 | 0 |
| JZ012059 | 130 | 22 | 151 | 0 |
| Sequence Alignments (This image is cropped. Click for full image.) |
|---|
 |
| Phylogeny |
|---|
 |