| Basic Information | |
|---|---|
| Species | Aquilegia coerulea |
| Cazyme ID | Aquca_058_00197.1 |
| Family | GH1 |
| Protein Properties | Length: 135 Molecular Weight: 15535.8 Isoelectric Point: 6.3484 |
| Chromosome | Chromosome/Scaffold: 58 Start: 1194727 End: 1195821 |
| Description | beta glucosidase 11 |
| View CDS | |
| External Links |
|---|
| CAZyDB |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
 | |||
| Family | Start | End | Evalue |
| GH1 | 2 | 124 | 0 |
| TNGDIACDGYHKYKEDMKIMKDIGLEAYRFSISWSRLLPYGRGIVNPKGVRYYNDLIDELVKNGIEPHVTIYHLDLPQILEEEYEGWLSPKIIGDFTAYA KVCFREFGDRVSHWTTLNELPTM | |||
| Full Sequence |
|---|
| Protein Sequence Length: 135 Download |
| KTNGDIACDG YHKYKEDMKI MKDIGLEAYR FSISWSRLLP YGRGIVNPKG VRYYNDLIDE 60 LVKNGIEPHV TIYHLDLPQI LEEEYEGWLS PKIIGDFTAY AKVCFREFGD RVSHWTTLNE 120 LPTMIPKVSQ AVHL* |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
 | ||||||||
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| TIGR03356 | BGL | 4.0e-58 | 3 | 120 | 118 | + beta-galactosidase. | ||
| pfam00232 | Glyco_hydro_1 | 3.0e-59 | 2 | 120 | 119 | + Glycosyl hydrolase family 1. | ||
| PLN02849 | PLN02849 | 1.0e-60 | 3 | 120 | 118 | + beta-glucosidase | ||
| PLN02814 | PLN02814 | 8.0e-64 | 1 | 120 | 120 | + beta-glucosidase | ||
| PLN02998 | PLN02998 | 2.0e-64 | 4 | 121 | 118 | + beta-glucosidase | ||
| Gene Ontology | |
|---|---|
| GO Term | Description |
| GO:0004553 | hydrolase activity, hydrolyzing O-glycosyl compounds |
| GO:0005975 | carbohydrate metabolic process |
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| RefSeq | NP_563666.1 | 0 | 4 | 121 | 74 | 191 | BGLU11 (BETA GLUCOSIDASE 11); catalytic/ cation binding / hydrolase, hydrolyzing O-glycosyl compounds [Arabidopsis thaliana] |
| RefSeq | NP_849578.5 | 0 | 4 | 121 | 74 | 191 | BGLU11 (BETA GLUCOSIDASE 11); hydrolase, hydrolyzing O-glycosyl compounds [Arabidopsis thaliana] |
| RefSeq | NP_973745.1 | 0 | 4 | 121 | 74 | 191 | BGLU11 (BETA GLUCOSIDASE 11); catalytic/ cation binding / hydrolase, hydrolyzing O-glycosyl compounds [Arabidopsis thaliana] |
| RefSeq | NP_973746.3 | 0 | 4 | 121 | 74 | 191 | BGLU11 (BETA GLUCOSIDASE 11); catalytic/ cation binding / hydrolase, hydrolyzing O-glycosyl compounds [Arabidopsis thaliana] |
| RefSeq | XP_002439662.1 | 0 | 3 | 129 | 75 | 200 | hypothetical protein SORBIDRAFT_09g018160 [Sorghum bicolor] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 4atl_B | 0 | 2 | 120 | 66 | 186 | A Chain A, Crystal Structure Of Chondroitin Polymerase From Escherichia Coli Strain K4 (K4cp) Complexed With Udp-Glcua And Udp |
| PDB | 4atl_A | 0 | 2 | 120 | 66 | 186 | A Chain A, Crystal Structure Of Chondroitin Polymerase From Escherichia Coli Strain K4 (K4cp) Complexed With Udp-Glcua And Udp |
| PDB | 4atd_B | 0 | 2 | 120 | 66 | 186 | A Chain A, Crystal Structure Of Native Raucaffricine Glucosidase |
| PDB | 4atd_A | 0 | 2 | 120 | 66 | 186 | A Chain A, Crystal Structure Of Native Raucaffricine Glucosidase |
| PDB | 4a3y_B | 0 | 2 | 120 | 66 | 186 | A Chain A, Crystal Structure Of Raucaffricine Glucosidase From Ajmaline Biosynthesis Pathway |
| Hydropathy |
|---|
 |
| EST Download unfiltered results here | ||||
|---|---|---|---|---|
 | ||||
| Hit | Length | Start | End | EValue |
| DT741932 | 124 | 2 | 125 | 0 |
| DT728125 | 123 | 2 | 124 | 0 |
| DR933090 | 124 | 2 | 125 | 0 |
| DR926347 | 123 | 2 | 124 | 0 |
| DR935172 | 124 | 2 | 125 | 0 |
| Orthologous Group | |||||
|---|---|---|---|---|---|
| Species | ID | ||||
| Aquilegia coerulea | Aquca_142_00002.1 | ||||
| Sequence Alignments (This image is cropped. Click for full image.) |
|---|
 |
| Phylogeny |
|---|
 |