| Basic Information | |
|---|---|
| Species | Brachypodium distachyon |
| Cazyme ID | Bradi3g19840.1 |
| Family | PL1 |
| Protein Properties | Length: 139 Molecular Weight: 15503.5 Isoelectric Point: 10.7288 |
| Chromosome | Chromosome/Scaffold: 3 Start: 18809562 End: 18810242 |
| Description | Pectin lyase-like superfamily protein |
| View CDS | |
| External Links |
|---|
| NCBI Taxonomy |
| Plaza |
| CAZyDB |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
 | |||
| Family | Start | End | Evalue |
| PL1 | 1 | 58 | 1.6e-22 |
| MRVTVAFNRFGPNVNQRMPRIRHGYAHVVNNLYDGWRDYAIGGSMGPSVKSQGNLFIA | |||
| Full Sequence |
|---|
| Protein Sequence Length: 139 Download |
| MRVTVAFNRF GPNVNQRMPR IRHGYAHVVN NLYDGWRDYA IGGSMGPSVK SQGNLFIASP 60 GNAKVTRRMP PVEHAREKEW HWHSVGDHFE NGASFNQMGS RVRPNYNKYQ AFHAANASEV 120 RSLTKDAGAL RCFAKAAC* |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
 | ||||||||
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| COG3866 | PelB | 2.0e-10 | 2 | 129 | 141 | + Pectate lyase [Carbohydrate transport and metabolism] | ||
| pfam00544 | Pec_lyase_C | 9.0e-20 | 1 | 56 | 56 | + Pectate lyase. This enzyme forms a right handed beta helix structure. Pectate lyase is an enzyme involved in the maceration and soft rotting of plant tissue. | ||
| smart00656 | Amb_all | 1.0e-24 | 1 | 60 | 60 | + Amb_all domain. | ||
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| DDBJ | BAD01325.1 | 0 | 1 | 138 | 240 | 384 | putative Cup s 1 pollen allergen [Oryza sativa Japonica Group] |
| GenBank | EAZ06386.1 | 0 | 1 | 138 | 240 | 384 | hypothetical protein OsI_28615 [Oryza sativa Indica Group] |
| RefSeq | XP_002299118.1 | 9.80909e-45 | 1 | 138 | 214 | 354 | predicted protein [Populus trichocarpa] |
| RefSeq | XP_002304865.1 | 1.4013e-45 | 1 | 138 | 214 | 352 | predicted protein [Populus trichocarpa] |
| RefSeq | XP_002458626.1 | 0 | 1 | 138 | 237 | 373 | hypothetical protein SORBIDRAFT_03g036930 [Sorghum bicolor] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 1pxz_B | 3e-28 | 1 | 130 | 213 | 345 | A Chain A, 1.7 Angstrom Crystal Structure Of Jun A 1, The Major Allergen From Cedar Pollen |
| PDB | 1pxz_A | 3e-28 | 1 | 130 | 213 | 345 | A Chain A, 1.7 Angstrom Crystal Structure Of Jun A 1, The Major Allergen From Cedar Pollen |
| PDB | 3zsc_A | 0.00001 | 2 | 73 | 183 | 270 | A Chain A, Catalytic Function And Substrate Recognition Of The Pectate Lyase From Thermotoga Maritima |
| PDB | 3krg_A | 0.005 | 1 | 35 | 264 | 297 | A Chain A, Structural Insights Into Substrate Specificity And The Anti Beta-Elimination Mechanism Of Pectate Lyase |
| PDB | 1vbl_A | 0.008 | 1 | 52 | 270 | 322 | A Chain A, Structure Of The Thermostable Pectate Lyase Pl 47 |
| Hydropathy |
|---|
 |
