y PlantCAZyme

CAZyme Information

Basic Information
SpeciesCitrus clementina
Cazyme IDCiclev10024030m
FamilyGH9
Protein PropertiesLength: 344 Molecular Weight: 38063.6 Isoelectric Point: 9.7425
ChromosomeChromosome/Scaffold: 3 Start: 50898700 End: 50900533
Descriptionglycosyl hydrolase 9B9
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH9323181.68156e-44
  TSYTNQLLAHAKQLFQFARNYPGLHQNSIPVIDKFYSSTRYEDELLLATAWLHRATNDRTYLNYLVSTGKTGGTRSLFAWDDKYVGAQVLAGRLVFEGQG
  SSGGDNNNNNNKSSTGASSRSSSTGTLLLPQYKSQAEQFIWSCVQEGNNNNNLQKTPGGLLWFQPWIKLQYAATATFVVTVCSNYLTAAHASIQCSGGLV
  QPSDLMDLARSQADYILRKNPKEMSYTRRINRINQDRQDSTPVARQGGFDLWFNSKAPNPNVLDGAVVGGPDENDGYTDSRGNFQFA
Full Sequence
Protein Sequence     Length: 344     Download
MERNNLRKTK TQIVGRFLDG LHPKIKRSSQ LTSYTNQLLA HAKQLFQFAR NYPGLHQNSI    60
PVIDKFYSST RYEDELLLAT AWLHRATNDR TYLNYLVSTG KTGGTRSLFA WDDKYVGAQV    120
LAGRLVFEGQ GSSGGDNNNN NNKSSTGASS RSSSTGTLLL PQYKSQAEQF IWSCVQEGNN    180
NNNLQKTPGG LLWFQPWIKL QYAATATFVV TVCSNYLTAA HASIQCSGGL VQPSDLMDLA    240
RSQADYILRK NPKEMSYTRR INRINQDRQD STPVARQGGF DLWFNSKAPN PNVLDGAVVG    300
GPDENDGYTD SRGNFQFAKP CHLLLHQHQH PLVVVGVSAS LAS*                     360
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02420PLN024203.0e-6234321305+
pfam00759Glyco_hydro_92.0e-6433316298+
PLN02171PLN021713.0e-7333320305+
PLN02340PLN023402.0e-7932320305+
PLN00119PLN001195.0e-11433320300+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAM14961.10473161257hypothetical protein [Arabidopsis thaliana]
RefSeqNP_181982.1033320201475AtGH9B9 (Arabidopsis thaliana glycosyl hydrolase 9B9); catalytic/ hydrolase, hydrolyzing O-glycosyl compounds
RefSeqNP_181983.1033320201474AtGH9B10 (Arabidopsis thaliana glycosyl hydrolase 9B10); catalytic/ hydrolase, hydrolyzing O-glycosyl compounds
RefSeqNP_181984.1033316201471AtGH9B11 (Arabidopsis thaliana glycosyl hydrolase 9B11); catalytic/ hydrolase, hydrolyzing O-glycosyl compounds
RefSeqNP_181985.1032320200476AtGH9B12 (Arabidopsis thaliana glycosyl hydrolase 9B12); catalytic/ hydrolase, hydrolyzing O-glycosyl compounds
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1ksd_A3e-3133315172408B Chain B, Crystal Structure Of The Complex Between Pectin Methylesterase And Its Inhibitor Protein
PDB1ksc_A3e-3133315172408B Chain B, Crystal Structure Of The Complex Between Pectin Methylesterase And Its Inhibitor Protein
PDB1ks8_A3e-3133315172408A Chain A, The Structure Of Endoglucanase From Termite, Nasutitermes Takasagoensis, At Ph 2.5.
PDB4tf4_B1e-1833315173420A Chain A, The Structure Of Endoglucanase From Termite, Nasutitermes Takasagoensis, At Ph 2.5.
PDB4tf4_A1e-1833315173420A Chain A, The Structure Of Endoglucanase From Termite, Nasutitermes Takasagoensis, At Ph 2.5.
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
GT742042305343210
DY968162288323030
EX680399297333120
FG1813532301023190
DR691236230332570
Orthologous Group
SpeciesID
Citrus sinensisorange1.1g043272m
Eucalyptus grandisEucgr.E01718.1.231.415Eucgr.E01718.1.231.415Eucgr.L02852.1.117.337Eucgr.L02852.1.117.337
Linum usitatissimumLus10030007
Picea abiesMA_20530g0010.192.444MA_20530g0010.192.444MA_10241783g0010.216.498MA_10241783g0010.216.498MA_774418g0010
Populus trichocarpaPotri.002G225400.1
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny