Basic Information | |
---|---|
Species | Zea mays |
Cazyme ID | GRMZM2G082792_T03 |
Family | AA6 |
Protein Properties | Length: 128 Molecular Weight: 13489.5 Isoelectric Point: 4.8486 |
Chromosome | Chromosome/Scaffold: 8 Start: 121883088 End: 121887432 |
Description | flavodoxin-like quinone reductase 1 |
View CDS |
External Links |
---|
NCBI Taxonomy |
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
AA6 | 4 | 126 | 0 |
KVYVVFYSTYGHVAKLAEEMKKGAASVEGVEVKVWQVPEILSEEVLGKMGAPPKTDAPVITPQELAEADGVLFGFPTRFGMMAAQMKAFFDATGGLWREQ SLAGKPAGLFFSTGSQGGGQETT |
Full Sequence |
---|
Protein Sequence Length: 128 Download |
MAVKVYVVFY STYGHVAKLA EEMKKGAASV EGVEVKVWQV PEILSEEVLG KMGAPPKTDA 60 PVITPQELAE ADGVLFGFPT RFGMMAAQMK AFFDATGGLW REQSLAGKPA GLFFSTGSQG 120 GGQETTP* |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
pfam00258 | Flavodoxin_1 | 2.0e-8 | 7 | 99 | 103 | + Flavodoxin. | ||
pfam03358 | FMN_red | 3.0e-11 | 17 | 110 | 97 | + NADPH-dependent FMN reductase. | ||
COG0655 | WrbA | 1.0e-23 | 1 | 110 | 117 | + Multimeric flavodoxin WrbA [General function prediction only] | ||
TIGR01755 | flav_wrbA | 3.0e-35 | 3 | 108 | 106 | + NAD(P)H:quinone oxidoreductase, type IV. This model represents a protein, WrbA, related to and slightly larger than flavodoxin. It was just shown, in E. coli and Archaeoglobus fulgidus (and previously for some eukaryotic homologs) to act as fourth type of NAD(P)H:quinone oxidoreductase. In E. coli, this protein was earlier reported to be produced during stationary phase, bind to the trp repressor, and make trp operon repression more efficient. WrbA does not interact with the trp operator by itself. Members are found in species in which homologs of the E. coli trp operon repressor TrpR are not detected [Energy metabolism, Electron transport]. | ||
PRK03767 | PRK03767 | 5.0e-42 | 3 | 110 | 108 | + NAD(P)H:quinone oxidoreductase; Provisional |
Gene Ontology | |
---|---|
GO Term | Description |
GO:0009055 | electron carrier activity |
GO:0010181 | FMN binding |
GO:0016491 | oxidoreductase activity |
GO:0050662 | coenzyme binding |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
GenBank | AAW78582.1 | 0 | 1 | 126 | 1 | 126 | quinone reductase 2 [Triticum monococcum] |
GenBank | EAY76084.1 | 0 | 1 | 127 | 1 | 127 | hypothetical protein OsI_04011 [Oryza sativa Indica Group] |
RefSeq | NP_001044464.1 | 0 | 1 | 127 | 1 | 127 | Os01g0784800 [Oryza sativa (japonica cultivar-group)] |
RefSeq | NP_001055969.1 | 0 | 1 | 127 | 1 | 127 | Os05g0501300 [Oryza sativa (japonica cultivar-group)] |
RefSeq | NP_001149575.1 | 0 | 1 | 127 | 1 | 127 | LOC100283201 [Zea mays] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 4dy4_C | 6e-34 | 4 | 126 | 2 | 122 | A Chain A, High Resolution Structure Of E.coli Wrba With Fmn |
PDB | 4dy4_A | 6e-34 | 4 | 126 | 2 | 122 | A Chain A, High Resolution Structure Of E.coli Wrba With Fmn |
PDB | 3b6m_B | 6e-34 | 4 | 126 | 3 | 123 | A Chain A, High Resolution Structure Of E.coli Wrba With Fmn |
PDB | 3b6m_A | 6e-34 | 4 | 126 | 3 | 123 | A Chain A, High Resolution Structure Of E.coli Wrba With Fmn |
PDB | 3b6k_B | 6e-34 | 4 | 126 | 3 | 123 | A Chain A, High Resolution Structure Of E.coli Wrba With Fmn |
Metabolic Pathways | |||
---|---|---|---|
Pathway Name | Reaction | EC | Protein Name |
hydrogen production VIII | RXN-12303 | EC-1.6.5.2 | NAD(P)H dehydrogenase (quinone) |