y PlantCAZyme

CAZyme Information

Basic Information
SpeciesZea mays
Cazyme IDGRMZM2G117999_T04
FamilyCE13
Protein PropertiesLength: 226 Molecular Weight: 23410.8 Isoelectric Point: 8.4867
ChromosomeChromosome/Scaffold: 9 Start: 117322465 End: 117326093
DescriptionPectinacetylesterase family protein
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
CE13392240
  RLTVPMTIVAGAASAGAVCLDGSPPAYHLHGGSGAGARSWLLQFEGGGWCNDVRSCAERAGTRRGSTRLMAKAESFSGILSNRPAMNPDFYNWNRVKLRY
  CDGGSFMGDSAVYINSSSVLYFSGQRIWDAIVADLLRKGLARADKVLLSGCSAGGLATFFHCDGLKQRLGAAATVKCLSDAGFFLD
Full Sequence
Protein Sequence     Length: 226     Download
MGPPRGWTLP AAAVATAGVA SVVATIILSA AAADVVEERL TVPMTIVAGA ASAGAVCLDG    60
SPPAYHLHGG SGAGARSWLL QFEGGGWCND VRSCAERAGT RRGSTRLMAK AESFSGILSN    120
RPAMNPDFYN WNRVKLRYCD GGSFMGDSAV YINSSSVLYF SGQRIWDAIV ADLLRKGLAR    180
ADKVLLSGCS AGGLATFFHC DGLKQRLGAA ATVKCLSDAG FFLDL*                   240
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam03283PAE1.0e-10137225189+
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankACN34427.1012251225unknown [Zea mays]
RefSeqNP_001065319.103722524211Os10g0550500 [Oryza sativa (japonica cultivar-group)]
RefSeqNP_001130561.1012121212hypothetical protein LOC100191660 [Zea mays]
RefSeqXP_002271673.10192243207PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002464971.1012251226hypothetical protein SORBIDRAFT_01g029710 [Sorghum bicolor]
Transmembrane Domains
StartEnd
1032
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
EE15888622612260
EE15721621212120
EE02093818411840
DR97132117611760
EE020938421842251e-16