y
Basic Information | |
---|---|
Species | Zea mays |
Cazyme ID | GRMZM2G123820_T01 |
Family | AA6 |
Protein Properties | Length: 128 Molecular Weight: 13610.5 Isoelectric Point: 6.9491 |
Chromosome | Chromosome/Scaffold: 6 Start: 106047284 End: 106048952 |
Description | Quinone reductase family protein |
View CDS |
External Links |
---|
NCBI Taxonomy |
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
AA6 | 8 | 73 | 6.3e-21 |
SPVWTAITQLAHHGMLFVPIGYTFGSGMFDMDGIRGGNPYGAGVFAGDGSRQPSETELALAEHQGQ |
Full Sequence |
---|
Protein Sequence Length: 128 Download |
MSGGTPDSPV WTAITQLAHH GMLFVPIGYT FGSGMFDMDG IRGGNPYGAG VFAGDGSRQP 60 SETELALAEH QGQVHGLHSE KASSPCLRQP PLCSRSHMVT FLWCSASPIV SGYIRPVVYV 120 HSLPYHL* 180 |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
COG0655 | WrbA | 7.0e-9 | 17 | 72 | 56 | + Multimeric flavodoxin WrbA [General function prediction only] | ||
TIGR01755 | flav_wrbA | 1.0e-18 | 4 | 73 | 71 | + NAD(P)H:quinone oxidoreductase, type IV. This model represents a protein, WrbA, related to and slightly larger than flavodoxin. It was just shown, in E. coli and Archaeoglobus fulgidus (and previously for some eukaryotic homologs) to act as fourth type of NAD(P)H:quinone oxidoreductase. In E. coli, this protein was earlier reported to be produced during stationary phase, bind to the trp repressor, and make trp operon repression more efficient. WrbA does not interact with the trp operator by itself. Members are found in species in which homologs of the E. coli trp operon repressor TrpR are not detected [Energy metabolism, Electron transport]. | ||
PRK03767 | PRK03767 | 7.0e-22 | 14 | 73 | 61 | + NAD(P)H:quinone oxidoreductase; Provisional |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
DDBJ | BAF26586.2 | 4e-34 | 11 | 73 | 9 | 71 | Os10g0436800 [Oryza sativa Japonica Group] |
EMBL | CAN79550.1 | 6e-34 | 3 | 90 | 71 | 158 | hypothetical protein [Vitis vinifera] |
EMBL | CBI17562.1 | 4e-35 | 3 | 73 | 70 | 140 | unnamed protein product [Vitis vinifera] |
RefSeq | NP_001147306.1 | 7e-37 | 3 | 73 | 165 | 235 | flavoprotein wrbA [Zea mays] |
RefSeq | XP_002273030.1 | 6e-34 | 2 | 73 | 173 | 244 | PREDICTED: hypothetical protein [Vitis vinifera] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 3b6m_B | 3e-16 | 2 | 77 | 116 | 192 | A Chain A, Crystal Structure Of Phl P 4, A Grass Pollen Allergen With Glucose Dehydrogenase Activity |
PDB | 3b6m_A | 3e-16 | 2 | 77 | 116 | 192 | A Chain A, Crystal Structure Of Phl P 4, A Grass Pollen Allergen With Glucose Dehydrogenase Activity |
PDB | 3b6k_B | 3e-16 | 2 | 77 | 116 | 192 | A Chain A, Crystal Structure Of Phl P 4, A Grass Pollen Allergen With Glucose Dehydrogenase Activity |
PDB | 3b6k_A | 3e-16 | 2 | 77 | 116 | 192 | A Chain A, Crystal Structure Of Phl P 4, A Grass Pollen Allergen With Glucose Dehydrogenase Activity |
PDB | 3b6j_B | 3e-16 | 2 | 77 | 116 | 192 | A Chain A, Crystal Structure Of Phl P 4, A Grass Pollen Allergen With Glucose Dehydrogenase Activity |