| Basic Information | |
|---|---|
| Species | Zea mays |
| Cazyme ID | GRMZM2G142011_T01 |
| Family | AA2 |
| Protein Properties | Length: 204 Molecular Weight: 21505.8 Isoelectric Point: 5.6659 |
| Chromosome | Chromosome/Scaffold: 5 Start: 53198991 End: 53200095 |
| Description | Peroxidase family protein |
| View CDS | |
| External Links |
|---|
| NCBI Taxonomy |
| CAZyDB |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
| Family | Start | End | Evalue |
| AA2 | 59 | 194 | 4.7e-32 |
| AAPATLRLFFHDCAVRGCDASVMLIDPAGGDEWRSPDGVMLKPEGFSTVMSAKAAVDSDPQCRNMVSCADILALAARDSVFLSGGPDYEVELGRFDGRVS SGGSVVVPHGTFDLDQLNAFFSSLGLSQTDMIALSG | |||
| Full Sequence |
|---|
| Protein Sequence Length: 204 Download |
| MRRLQFLAAA AAAIFLLALP LMATAQPKLR PDYYAGVCPN LESIVRGAVR QSVALSPLAA 60 PATLRLFFHD CAVRGCDASV MLIDPAGGDE WRSPDGVMLK PEGFSTVMSA KAAVDSDPQC 120 RNMVSCADIL ALAARDSVFL SGGPDYEVEL GRFDGRVSSG GSVVVPHGTF DLDQLNAFFS 180 SLGLSQTDMI ALSGTCQRAR VHI* 240 |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| PLN02879 | PLN02879 | 1.0e-5 | 123 | 202 | 80 | + L-ascorbate peroxidase | ||
| cd00314 | plant_peroxidase_like | 6.0e-6 | 43 | 194 | 167 | + Heme-dependent peroxidases similar to plant peroxidases. Along with animal peroxidases, these enzymes belong to a group of peroxidases containing a heme prosthetic group (ferriprotoporphyrin IX), which catalyzes a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. The plant peroxidase-like superfamily is found in all three kingdoms of life and carries out a variety of biosynthetic and degradative functions. Several sub-families can be identified. Class I includes intracellular peroxidases present in fungi, plants, archaea and bacteria, called catalase-peroxidases, that can exhibit both catalase and broad-spectrum peroxidase activities depending on the steady-state concentration of hydrogen peroxide. Catalase-peroxidases are typically comprised of two homologous domains that probably arose via a single gene duplication event. Class II includes ligninase and other extracellular fungal peroxidases, while class III is comprised of classic extracellular plant peroxidases, like horseradish peroxidase. | ||
| PLN03030 | PLN03030 | 4.0e-28 | 30 | 194 | 166 | + cationic peroxidase; Provisional | ||
| pfam00141 | peroxidase | 1.0e-41 | 45 | 194 | 151 | + Peroxidase. | ||
| cd00693 | secretory_peroxidase | 2.0e-63 | 28 | 194 | 169 | + Horseradish peroxidase and related secretory plant peroxidases. Secretory peroxidases belong to class III of the plant heme-dependent peroxidase superfamily. All members of the superfamily share a heme prosthetic group and catalyze a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. Class III peroxidases are found in the extracellular space or in the vacuole in plants where they have been implicated in hydrogen peroxide detoxification, auxin catabolism and lignin biosynthesis, and stress response. Class III peroxidases contain four conserved disulphide bridges and two conserved calcium binding sites. | ||
| Gene Ontology | |
|---|---|
| GO Term | Description |
| GO:0004601 | peroxidase activity |
| GO:0006979 | response to oxidative stress |
| GO:0020037 | heme binding |
| GO:0055114 | oxidation-reduction process |
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| GenBank | ACN36168.1 | 0 | 27 | 203 | 27 | 203 | unknown [Zea mays] |
| GenBank | EEE66278.1 | 0 | 17 | 194 | 3 | 177 | hypothetical protein OsJ_22482 [Oryza sativa Japonica Group] |
| RefSeq | NP_001058447.1 | 0 | 1 | 194 | 1 | 190 | Os06g0695200 [Oryza sativa (japonica cultivar-group)] |
| RefSeq | NP_001151822.1 | 0 | 27 | 194 | 27 | 194 | peroxidase 16 [Zea mays] |
| RefSeq | XP_002438930.1 | 0 | 1 | 194 | 1 | 190 | hypothetical protein SORBIDRAFT_10g028460 [Sorghum bicolor] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 1qgj_B | 6e-32 | 28 | 194 | 1 | 163 | A Chain A, Arabidopsis Thaliana Peroxidase N |
| PDB | 1qgj_A | 6e-32 | 28 | 194 | 1 | 163 | A Chain A, Arabidopsis Thaliana Peroxidase N |
| PDB | 1qo4_A | 6e-29 | 28 | 203 | 2 | 179 | A Chain A, Arabidopsis Thaliana Peroxidase N |
| PDB | 1pa2_A | 6e-29 | 28 | 203 | 2 | 179 | A Chain A, Arabidopsis Thaliana Peroxidase A2 |
| PDB | 1bgp_A | 6e-28 | 27 | 194 | 7 | 177 | A Chain A, Crystal Structure Of Barley Grain Peroxidase 1 |
