y PlantCAZyme

CAZyme Information

Basic Information
SpeciesZea mays
Cazyme IDGRMZM2G143747_T02
FamilyGH9
Protein PropertiesLength: 138 Molecular Weight: 15001.8 Isoelectric Point: 4.1961
ChromosomeChromosome/Scaffold: 8 Start: 112767408 End: 112768346
Descriptionglycosyl hydrolase 9C2
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH971370
  QVDLVGGYYDAGDNVKFGLPMAFTVTMMSWGILEYGRQMAAVGELRNAMDAVKWGTDYFIKAHPEPEVLYGEVGDGDTDHGCWQRPEDMSTSRQAFRIDP
  QNPGSDLAGETAAAMAAASLVFRSTYPGYAN
Full Sequence
Protein Sequence     Length: 138     Download
MFCLAGQVDL VGGYYDAGDN VKFGLPMAFT VTMMSWGILE YGRQMAAVGE LRNAMDAVKW    60
GTDYFIKAHP EPEVLYGEVG DGDTDHGCWQ RPEDMSTSRQ AFRIDPQNPG SDLAGETAAA    120
MAAASLVFRS TYPGYANL                                                  180
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02340PLN023404.0e-628138131+
pfam00759Glyco_hydro_93.0e-638138131+
PLN00119PLN001195.0e-658137130+
PLN02420PLN024201.0e-698138131+
PLN02171PLN021712.0e-915138134+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankACN25631.10513867200unknown [Zea mays]
GenBankACN27322.1011381138unknown [Zea mays]
GenBankEAY96964.10513868201hypothetical protein OsI_18884 [Oryza sativa Indica Group]
RefSeqNP_001054920.10513873206Os05g0212300 [Oryza sativa (japonica cultivar-group)]
RefSeqXP_002440792.10513867200hypothetical protein SORBIDRAFT_09g006670 [Sorghum bicolor]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1ksd_A9.99967e-42913747175A Chain A, The Structure Of Endoglucanase From Termite, Nasutitermes Takasagoensis, At Ph 2.5.
PDB1ksc_A9.99967e-42913747175A Chain A, The Structure Of Endoglucanase From Termite, Nasutitermes Takasagoensis, At Ph 2.5.
PDB1ks8_A9.99967e-42913747175A Chain A, The Structure Of Endoglucanase From Termite, Nasutitermes Takasagoensis, At Ph 2.5.
PDB4tf4_B3e-35813647175A Chain A, The Structure Of Endoglucanase From Termite, Nasutitermes Takasagoensis, At Ph 2.5.
PDB4tf4_A3e-35813647175A Chain A, The Structure Of Endoglucanase From Termite, Nasutitermes Takasagoensis, At Ph 2.5.
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
EB63797713811380
DV17123513451380
EE16433913451380
DY68935513451380
DR82844913451380