y
Basic Information | |
---|---|
Species | Zea mays |
Cazyme ID | GRMZM2G159643_T02 |
Family | AA6 |
Protein Properties | Length: 121 Molecular Weight: 12597.3 Isoelectric Point: 8.4922 |
Chromosome | Chromosome/Scaffold: 8 Start: 171852176 End: 171855802 |
Description | Quinone reductase family protein |
View CDS |
External Links |
---|
NCBI Taxonomy |
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
AA6 | 2 | 115 | 0 |
MAAQMKAFFDATGGLWREQSLAGKPAGVFFCTGSQGGGQETTALTAITQLTHHGMVFVPVGYTFGAKLFGMDQVQGGSPYGAGTFAADGSRWPSEVELEH AFHQGKYFAGIAKK |
Full Sequence |
---|
Protein Sequence Length: 121 Download |
MMAAQMKAFF DATGGLWREQ SLAGKPAGVF FCTGSQGGGQ ETTALTAITQ LTHHGMVFVP 60 VGYTFGAKLF GMDQVQGGSP YGAGTFAADG SRWPSEVELE HAFHQGKYFA GIAKKLKGSA 120 * 180 |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
pfam03358 | FMN_red | 2.0e-6 | 1 | 63 | 63 | + NADPH-dependent FMN reductase. | ||
COG0655 | WrbA | 3.0e-29 | 1 | 118 | 119 | + Multimeric flavodoxin WrbA [General function prediction only] | ||
TIGR01755 | flav_wrbA | 1.0e-36 | 1 | 116 | 117 | + NAD(P)H:quinone oxidoreductase, type IV. This model represents a protein, WrbA, related to and slightly larger than flavodoxin. It was just shown, in E. coli and Archaeoglobus fulgidus (and previously for some eukaryotic homologs) to act as fourth type of NAD(P)H:quinone oxidoreductase. In E. coli, this protein was earlier reported to be produced during stationary phase, bind to the trp repressor, and make trp operon repression more efficient. WrbA does not interact with the trp operator by itself. Members are found in species in which homologs of the E. coli trp operon repressor TrpR are not detected [Energy metabolism, Electron transport]. | ||
PRK03767 | PRK03767 | 4.0e-48 | 1 | 118 | 119 | + NAD(P)H:quinone oxidoreductase; Provisional |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
GenBank | AAW78582.1 | 0 | 1 | 120 | 84 | 203 | quinone reductase 2 [Triticum monococcum] |
GenBank | ACF86423.1 | 0 | 1 | 120 | 84 | 203 | unknown [Zea mays] |
GenBank | EAY76084.1 | 0 | 1 | 120 | 84 | 203 | hypothetical protein OsI_04011 [Oryza sativa Indica Group] |
RefSeq | NP_001149575.1 | 0 | 1 | 120 | 84 | 203 | LOC100283201 [Zea mays] |
RefSeq | NP_001151729.1 | 0 | 1 | 120 | 84 | 203 | LOC100285365 [Zea mays] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 4dy4_C | 2e-32 | 2 | 118 | 82 | 197 | A Chain A, High Resolution Structure Of E.coli Wrba With Fmn |
PDB | 4dy4_A | 2e-32 | 2 | 118 | 82 | 197 | A Chain A, High Resolution Structure Of E.coli Wrba With Fmn |
PDB | 3b6m_B | 2e-32 | 2 | 118 | 83 | 198 | A Chain A, High Resolution Structure Of E.coli Wrba With Fmn |
PDB | 3b6m_A | 2e-32 | 2 | 118 | 83 | 198 | A Chain A, High Resolution Structure Of E.coli Wrba With Fmn |
PDB | 3b6k_B | 2e-32 | 2 | 118 | 83 | 198 | A Chain A, High Resolution Structure Of E.coli Wrba With Fmn |
Metabolic Pathways | |||
---|---|---|---|
Pathway Name | Reaction | EC | Protein Name |
hydrogen production VIII | RXN-12303 | EC-1.6.5.2 | NAD(P)H dehydrogenase (quinone) |