y PlantCAZyme

CAZyme Information

Basic Information
SpeciesZea mays
Cazyme IDGRMZM5G854948_T02
FamilyCE13
Protein PropertiesLength: 390 Molecular Weight: 43362.9 Isoelectric Point: 5.2505
ChromosomeChromosome/Scaffold: 6 Start: 113598338 End: 113603773
Description
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
CE132783761e-36
  QFRHILASPSSDPGGHWSRCKSDLGGCSATQIATLQGLRSGMLTSLRQSESKPKAGVFINSCFAHCQSELQDTWFAPNSPSIDNKKIAEVVGDWYFERG
Full Sequence
Protein Sequence     Length: 390     Download
MPSPTRASVA SLPTAGAVLS CRAHRASRWP THTRSTLHPK KSACAWEERV LDVDKYAIMH    60
CGVQEILHWM APGTPQMEGA REDDGNDLLE MQAYDPETYN DKVIGALCVS SSEVVGNWCE    120
SRVGSNTTEQ QGMLKRALEF NWQMLLEDIG LWIPPTIYHI EHDDKPENEP EGYFVYAAYV    180
ASIVDYILWV INEIIPGPPL PPECNTELHT DYGGTAVRWG LTHHKESAAD CCQACIDQAK    240
MARPGALKCN IWVYCPSEYG CYSPDKYEHK HQECWLKQFR HILASPSSDP GGHWSRCKSD    300
LGGCSATQIA TLQGLRSGML TSLRQSESKP KAGVFINSCF AHCQSELQDT WFAPNSPSID    360
NKKIAEVVGD WYFERGAAVE IDCAYPCDS*                                     420
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam03283PAE6.0e-3327837598+
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankACN34596.1012728197232unknown [Zea mays]
GenBankACN36429.1027838980191unknown [Zea mays]
GenBankEEC80221.10127281165300hypothetical protein OsI_22145 [Oryza sativa Indica Group]
RefSeqNP_001057130.10127281165300Os06g0214100 [Oryza sativa (japonica cultivar-group)]
RefSeqXP_002436698.10125281158295hypothetical protein SORBIDRAFT_10g007210 [Sorghum bicolor]
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
FL4596601531272790
JG8127911551272810
DN2255401122783890
JG8042291551272810
FL4633951122783890