| Basic Information | |
|---|---|
| Species | Glycine max |
| Cazyme ID | Glyma14g22991.1 |
| Family | GH1 |
| Protein Properties | Length: 90 Molecular Weight: 10346.8 Isoelectric Point: 4.7782 |
| Chromosome | Chromosome/Scaffold: 14 Start: 27297925 End: 27298434 |
| Description | beta glucosidase 31 |
| View CDS | |
| External Links |
|---|
| NCBI Taxonomy |
| Plaza |
| CAZyDB |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
| Family | Start | End | Evalue |
| GH1 | 2 | 88 | 7.6e-30 |
| DNSNKDVIIGAYHHCKEDVGMMKDMNLDSYRFSIYWSRILPKGKLSGGINREGINYYNNLINELDLPQALEDEYGEFLSPRIVKLFI | |||
| Full Sequence |
|---|
| Protein Sequence Length: 90 Download |
| MDNSNKDVII GAYHHCKEDV GMMKDMNLDS YRFSIYWSRI LPKGKLSGGI NREGINYYNN 60 LINELDLPQA LEDEYGEFLS PRIVKLFID* 120 |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| PLN02814 | PLN02814 | 2.0e-22 | 2 | 87 | 100 | + beta-glucosidase | ||
| COG2723 | BglB | 2.0e-23 | 5 | 87 | 97 | + Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism] | ||
| PLN02998 | PLN02998 | 2.0e-24 | 7 | 87 | 95 | + beta-glucosidase | ||
| TIGR03356 | BGL | 5.0e-25 | 1 | 89 | 103 | + beta-galactosidase. | ||
| pfam00232 | Glyco_hydro_1 | 3.0e-27 | 2 | 89 | 102 | + Glycosyl hydrolase family 1. | ||
| Gene Ontology | |
|---|---|
| GO Term | Description |
| GO:0004553 | hydrolase activity, hydrolyzing O-glycosyl compounds |
| GO:0005975 | carbohydrate metabolic process |
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| GenBank | ABW76287.1 | 5e-34 | 1 | 89 | 80 | 182 | beta-glucosidase G2 [Medicago truncatula] |
| GenBank | ACD65511.1 | 2e-35 | 2 | 89 | 86 | 187 | beta-glucosidase D7 [Lotus japonicus] |
| GenBank | ACJ85659.1 | 5e-34 | 1 | 89 | 80 | 182 | unknown [Medicago truncatula] |
| DDBJ | BAF34333.1 | 2e-34 | 2 | 89 | 87 | 188 | isoflavone conjugate-specific beta-glucosidase [Glycine max] |
| DDBJ | BAG13451.1 | 3e-34 | 2 | 89 | 82 | 183 | beta-glucosidase [Rosa hybrid cultivar] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 1cbg_A | 9e-33 | 2 | 89 | 61 | 162 | A Chain A, The Crystal Structure Of A Cyanogenic Beta-Glucosidase From White Clover (Trifolium Repens L.), A Family 1 Glycosyl-Hydrolase |
| PDB | 4ek7_B | 2e-31 | 4 | 89 | 66 | 165 | A Chain A, The Crystal Structure Of A Cyanogenic Beta-Glucosidase From White Clover (Trifolium Repens L.), A Family 1 Glycosyl-Hydrolase |
| PDB | 4ek7_A | 2e-31 | 4 | 89 | 66 | 165 | A Chain A, The Crystal Structure Of A Cyanogenic Beta-Glucosidase From White Clover (Trifolium Repens L.), A Family 1 Glycosyl-Hydrolase |
| PDB | 3u5y_B | 2e-31 | 4 | 89 | 66 | 165 | A Chain A, The Crystal Structure Of A Cyanogenic Beta-Glucosidase From White Clover (Trifolium Repens L.), A Family 1 Glycosyl-Hydrolase |
| PDB | 3u5y_A | 2e-31 | 4 | 89 | 66 | 165 | A Chain A, The Crystal Structure Of A Cyanogenic Beta-Glucosidase From White Clover (Trifolium Repens L.), A Family 1 Glycosyl-Hydrolase |
| Metabolic Pathways | |||
|---|---|---|---|
| Pathway Name | Reaction | EC | Protein Name |
| coumarin biosynthesis (via 2-coumarate) | RXN-8036 | EC-3.2.1.21 | β-glucosidase |
| linamarin degradation | RXN-5341 | EC-3.2.1.21 | β-glucosidase |
| linustatin bioactivation | RXN-13602 | EC-3.2.1.21 | β-glucosidase |
| linustatin bioactivation | RXN-5341 | EC-3.2.1.21 | β-glucosidase |
| lotaustralin degradation | RXN-9674 | EC-3.2.1.21 | β-glucosidase |
| neolinustatin bioactivation | RXN-13603 | EC-3.2.1.21 | β-glucosidase |
| neolinustatin bioactivation | RXN-9674 | EC-3.2.1.21 | β-glucosidase |
| taxiphyllin bioactivation | RXN-13600 | EC-3.2.1.21 | β-glucosidase |
| Hydropathy |
|---|
 |