| Basic Information | |
|---|---|
| Species | Glycine max |
| Cazyme ID | Glyma20g15800.1 |
| Family | GH9 |
| Protein Properties | Length: 139 Molecular Weight: 15404.6 Isoelectric Point: 9.3723 |
| Chromosome | Chromosome/Scaffold: 20 Start: 21569219 End: 21569733 |
| Description | glycosyl hydrolase 9A4 |
| View CDS | |
| External Links |
|---|
| NCBI Taxonomy |
| Plaza |
| CAZyDB |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
 | |||
| Family | Start | End | Evalue |
| GH9 | 30 | 129 | 8.7e-29 |
| NYKEALTKGTTFNEAQCTRKYSANTRKLPSNNRVPWRGDSTLDDGKLANVDLVGGYYDAGDNVKYGLPMAFTVTTLAWGAIFYKSEFKAANELDNIQDAI | |||
| Full Sequence |
|---|
| Protein Sequence Length: 139 Download |
| MGTKQVCWAI IVVWLTLLEG NTMLVKGDFN YKEALTKGTT FNEAQCTRKY SANTRKLPSN 60 NRVPWRGDST LDDGKLANVD LVGGYYDAGD NVKYGLPMAF TVTTLAWGAI FYKSEFKAAN 120 ELDNIQDAIL KASSRHKR* |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
 | ||||||||
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| PLN02171 | PLN02171 | 4.0e-33 | 30 | 129 | 100 | + endoglucanase | ||
| PLN02340 | PLN02340 | 3.0e-33 | 29 | 129 | 101 | + endoglucanase | ||
| PLN02613 | PLN02613 | 4.0e-34 | 9 | 129 | 121 | + endoglucanase | ||
| pfam00759 | Glyco_hydro_9 | 2.0e-36 | 30 | 129 | 102 | + Glycosyl hydrolase family 9. | ||
| PLN02909 | PLN02909 | 2.0e-51 | 9 | 138 | 142 | + Endoglucanase | ||
| Gene Ontology | |
|---|---|
| GO Term | Description |
| GO:0004553 | hydrolase activity, hydrolyzing O-glycosyl compounds |
| GO:0005975 | carbohydrate metabolic process |
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| EMBL | CAN82881.1 | 1e-39 | 28 | 138 | 12 | 122 | hypothetical protein [Vitis vinifera] |
| EMBL | CAN82882.1 | 3e-40 | 27 | 138 | 29 | 140 | hypothetical protein [Vitis vinifera] |
| EMBL | CBI20730.1 | 4e-38 | 1 | 138 | 486 | 625 | unnamed protein product [Vitis vinifera] |
| EMBL | CBI20730.1 | 5.04467e-44 | 9 | 138 | 10 | 140 | unnamed protein product [Vitis vinifera] |
| RefSeq | NP_189972.2 | 2e-37 | 21 | 138 | 24 | 142 | AtGH9A4 (Arabidopsis thaliana Glycosyl Hydrolase 9A4); catalytic/ hydrolase, hydrolyzing O-glycosyl compounds |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 4tf4_B | 6e-24 | 29 | 127 | 4 | 95 | A Chain A, Structure And Activity Of A Flavonoid 3-O Glucosyltransferase Reveals The Basis For Plant Natural Product Modification |
| PDB | 4tf4_A | 6e-24 | 29 | 127 | 4 | 95 | A Chain A, Structure And Activity Of A Flavonoid 3-O Glucosyltransferase Reveals The Basis For Plant Natural Product Modification |
| PDB | 3tf4_B | 6e-24 | 29 | 127 | 4 | 95 | A Chain A, Structure And Activity Of A Flavonoid 3-O Glucosyltransferase Reveals The Basis For Plant Natural Product Modification |
| PDB | 3tf4_A | 6e-24 | 29 | 127 | 4 | 95 | A Chain A, Structure And Activity Of A Flavonoid 3-O Glucosyltransferase Reveals The Basis For Plant Natural Product Modification |
| PDB | 1tf4_B | 6e-24 | 29 | 127 | 4 | 95 | A Chain A, Structure And Activity Of A Flavonoid 3-O Glucosyltransferase Reveals The Basis For Plant Natural Product Modification |
