y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGossypium raimondii
Cazyme IDGorai.008G271500.8
FamilyGH1
Protein PropertiesLength: 366 Molecular Weight: 41579.6 Isoelectric Point: 9.2183
ChromosomeChromosome/Scaffold: 08 Start: 55056473 End: 55060592
Descriptionbeta glucosidase 17
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH1191590
  SCFPPGFIFGAGSAAYQIEGAALEDGKGASVWDILVRQHPERIVDRSTGDVAVDFYHRYKEDIMLMKKIGLDSFRFSISWTRILPKAKLSGGVNPLGVQF
  YNNLIDDLLANGLKPFVTLLHFDHPQALEDEYGGFSSPKIM
GH11593630
  MFMDPVIYGEYPKSMQSLVGNRLPKFTEAESKLLKGSIDFLGANYYTTNYAENGPSNTPFLPTDARVNLTTEKNGVPIGTPTDVSWLFNYPKGLRDLLLY
  LKKKYNSPTIYITENGVAEANNASLTVKEALKDSTRIRYLDGHLKYLLKAIQEGVNIKGHYMWAFLDDFEWTSGYTLRFGFTYIDYKNNLRRYLKYSAYW
  FKKFL
Full Sequence
Protein Sequence     Length: 366     Download
MVVMDGAIAS HKWRPFNRSC FPPGFIFGAG SAAYQIEGAA LEDGKGASVW DILVRQHPER    60
IVDRSTGDVA VDFYHRYKED IMLMKKIGLD SFRFSISWTR ILPKAKLSGG VNPLGVQFYN    120
NLIDDLLANG LKPFVTLLHF DHPQALEDEY GGFSSPKIMF MDPVIYGEYP KSMQSLVGNR    180
LPKFTEAESK LLKGSIDFLG ANYYTTNYAE NGPSNTPFLP TDARVNLTTE KNGVPIGTPT    240
DVSWLFNYPK GLRDLLLYLK KKYNSPTIYI TENGVAEANN ASLTVKEALK DSTRIRYLDG    300
HLKYLLKAIQ EGVNIKGHYM WAFLDDFEWT SGYTLRFGFT YIDYKNNLRR YLKYSAYWFK    360
KFLLN*                                                               420
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
TIGR03356BGL3.0e-41159359201+
COG2723BglB7.0e-5621158139+
pfam00232Glyco_hydro_13.0e-56160362205+
TIGR03356BGL1.0e-5622184163+
pfam00232Glyco_hydro_11.0e-5721158138+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCAN72287.101636330435hypothetical protein [Vitis vinifera]
GenBankEEE68974.102236310314hypothetical protein OsJ_27885 [Oryza sativa Japonica Group]
RefSeqXP_002330884.10115919177predicted protein [Populus trichocarpa]
RefSeqXP_002330884.10160365302510predicted protein [Populus trichocarpa]
RefSeqXP_002330885.10160365302510predicted protein [Populus trichocarpa]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3ptq_B0160364297504A Chain A, The Crystal Structure Of Rice (Oryza Sativa L.) Os4bglu12
PDB3ptq_B01515928172A Chain A, The Crystal Structure Of Rice (Oryza Sativa L.) Os4bglu12
PDB3ptq_A0160364297504A Chain A, The Crystal Structure Of Rice (Oryza Sativa L.) Os4bglu12
PDB3ptq_A01515928172A Chain A, The Crystal Structure Of Rice (Oryza Sativa L.) Os4bglu12
PDB3ptm_B0160364297504A Chain A, The Crystal Structure Of Rice (Oryza Sativa L.) Os4bglu12
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
FP0316262091603660
CX6657522101603660
CU48136515821590
FN7211262181623660
CU5815201542133660
Orthologous Group
SpeciesID
Carica papayaevm.model.supercontig_80.122
Citrus clementinaCiclev10015201m.21.131Ciclev10015201m.21.131
Citrus sinensisorange1.1g011733morange1.1g011332morange1.1g009558m.263.398orange1.1g009558m.263.398orange1.1g012826m.21.131
orange1.1g012826m.21.131
Cucumis sativusCucsa.029410.3.39.146Cucsa.029410.3.39.146
Glycine maxGlyma08g15960.3.44.235Glyma08g15960.3.44.235Glyma08g15976.1
Gossypium raimondiiGorai.008G271500.8.19.159Gorai.008G271500.8.19.159
Malus domesticaMDP0000284502.19.158MDP0000133222MDP0000772476MDP0000226997.39.150MDP0000226997.39.150
MDP0000232427.19.173MDP0000232427.19.173MDP0000284502.19.158
Oryza sativaLOC_Os11g08120.1
Panicum virgatumPavirv00054444mPavirv00056446mPavirv00050690m
Picea abiesMA_10425794g0020MA_781664g0010MA_10436515g0020MA_952732g0010.27.180MA_952732g0010.27.180
MA_946576g0010.42.153MA_10182879g0010MA_10431319g0010.36.144MA_10431319g0010.36.144MA_946576g0010.42.153
Prunus persicappa021869mppa022831m
Vitis viniferaGSVIVT01028004001.708.838GSVIVT01028004001.708.838GSVIVT01028004001.708.838GSVIVT01032021001GSVIVT01003998001
GSVIVT01028002001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny