y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGossypium raimondii
Cazyme IDGorai.009G178700.6
FamilyCBM53
Protein PropertiesLength: 733 Molecular Weight: 84509.5 Isoelectric Point: 6.5285
ChromosomeChromosome/Scaffold: 09 Start: 13795544 End: 13800719
Descriptionstarch synthase 3
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
CBM532793627.5e-32
  EDIEVFFNRSFSTLNDEQDILIMGAFNDWRWRSFTMRLNKTYFKGDWWSCQIHVPKEAYKMDFVFFNGQNIYDNNDKQDFCIIV
CBM534545432.4e-33
  DKVKLYYNKTSGPLAHANELWIHGGHNNWCNGLTIVEKFLRSGREGGDWWYAEVVVPGRALVLDWVFADGPPKVATIYDNNNYQDFHAVV
CBM536157035e-35
  GSTVTVFYNPANTVLNGKHEIWFRCSFNRWTHRMGPLPPQRMLPADNGSHVKATVKVPLDAYMMDFVFSEREDGGMFDNKGGMDYHIPV
Full Sequence
Protein Sequence     Length: 733     Download
MDVSLQLQRP LRFKEVLNHR TDCFKIRPFL GSLSFARTIQ FTPWRCECLP SRVSLRVTAG    60
AADFSKRRQR RLSTRSSKSS KGFGRKTKLG TGNQKRDQKD NGENEDSNIP TLSESEESNQ    120
TEMESTVAVD EESTIALYQK NKVNESEKEE LKEDVPSKTK SYLNAENGSA RKVVEDVLGL    180
QKKELILEND TVSTSRDAAT YEGKHFTDYA ITEEKHLAGT ETDGTVTGKD EKTIEDASAK    240
LKLEMEEKLR KQEIERLAEG NFLKGNKIFV YPQTVRPDED IEVFFNRSFS TLNDEQDILI    300
MGAFNDWRWR SFTMRLNKTY FKGDWWSCQI HVPKEAYKMD FVFFNGQNIY DNNDKQDFCI    360
IVEGGMDVFA FEDFLLEEKR RELEKLAKEQ AEKERQEEEQ RRIEAEKAAS EADRAQAKVE    420
TGKRREILEQ LMKQAPRSVD NIWFIEPNEF KGADKVKLYY NKTSGPLAHA NELWIHGGHN    480
NWCNGLTIVE KFLRSGREGG DWWYAEVVVP GRALVLDWVF ADGPPKVATI YDNNNYQDFH    540
AVVPKSIPEE MFWVEEEHQI FRKLQAERKL REEAIRAKAE KTARMKAEMK ERTLKRFLLS    600
QKHIVYTEPL DVHAGSTVTV FYNPANTVLN GKHEIWFRCS FNRWTHRMGP LPPQRMLPAD    660
NGSHVKATVK VPLDAYMMDF VFSEREDGGM FDNKGGMDYH IPVFGGIVKE PPMHIVHIAV    720
EMAPIAKVNF GH*                                                       780
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
smart01066CBM_252.0e-1627836084+
pfam03423CBM_255.0e-3045354492+
pfam03423CBM_254.0e-3161570389+
pfam03423CBM_253.0e-3427836387+
PLN02316PLN02316094728636+
Gene Ontology
GO TermDescription
GO:2001070starch binding
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
DDBJBAF49176.1017281730starch synthase III [Phaseolus vulgaris]
EMBLCAA64173.1017281795soluble-starch-synthase [Solanum tuberosum]
RefSeqXP_002269011.1017281707PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002305571.107972810584predicted protein [Populus trichocarpa]
RefSeqXP_002518476.10727281625starch synthase, putative [Ricinus communis]
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO7780035042257280
ES8337652654276910
HO7954664151755780
HO7954663074187032e-20
ES8337652302664860.00000000002
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_005_00047.2.247.331Aquca_005_00047.2.247.331Aquca_005_00047.2.247.331Aquca_005_00047.1.247.331Aquca_005_00047.1.247.331
Aquca_005_00047.1.247.331Aquca_005_00047.1.423.513Aquca_005_00047.1.423.513Aquca_005_00047.1.423.513Aquca_005_00047.2.581.669
Aquca_005_00047.2.581.669Aquca_005_00047.2.581.669Aquca_005_00047.1.585.673Aquca_005_00047.1.585.673Aquca_005_00047.1.585.673
Aquca_005_00047.2.423.509Aquca_005_00047.2.423.509Aquca_005_00047.2.423.509
Arabidopsis lyrata312200.125.208312200.125.208312200.125.208312200.474.562312200.474.562
312200.474.562312200.300.401312200.300.401312200.300.401
Arabidopsis thalianaAT1G11720.2.206.289AT1G11720.2.206.289AT1G11720.2.206.289AT1G11720.1.154.237AT1G11720.1.154.237
AT1G11720.1.154.237AT1G11720.2.381.475AT1G11720.2.381.475AT1G11720.2.381.475AT1G11720.1.329.423
AT1G11720.1.329.423AT1G11720.1.329.423AT1G11720.2.548.636AT1G11720.2.548.636AT1G11720.2.548.636
AT1G11720.1.496.584AT1G11720.1.496.584AT1G11720.1.496.584
Brachypodium distachyonBradi5g22310.1.403.486Bradi5g22310.1.403.486Bradi5g22310.1.403.486Bradi3g15027.1.835.918Bradi3g15027.1.835.918
Bradi3g15027.1.835.918Bradi5g22310.1.577.667Bradi5g22310.1.577.667Bradi5g22310.1.577.667Bradi5g22310.1.739.827
Bradi5g22310.1.739.827Bradi5g22310.1.739.827
Brassica rapaBra016818.430.514Bra016818.430.514Bra016818.430.514Bra019836.120.208Bra016818.605.694
Bra016818.605.694Bra016818.605.694Bra016818.767.855Bra016818.767.855Bra016818.767.855
Carica papayaevm.model.supercontig_152.17.311.394evm.model.supercontig_152.17.311.394evm.model.supercontig_152.17.311.394evm.model.supercontig_152.17.486.575evm.model.supercontig_152.17.486.575
evm.model.supercontig_152.17.486.575evm.model.supercontig_152.17.647.735evm.model.supercontig_152.17.647.735evm.model.supercontig_152.17.647.735
Capsella rubellaCarubv10011175m.206.289Carubv10011175m.206.289Carubv10011175m.206.289Carubv10011175m.381.474Carubv10011175m.381.474
Carubv10011175m.381.474Carubv10011175m.547.635Carubv10011175m.547.635Carubv10011175m.547.635
Chlamydomonas reinhardtiiCre06.g282000.t2.1.660.749Cre06.g282000.t2.1.660.749Cre06.g282000.t1.3.696.785Cre06.g282000.t1.3.696.785Cre06.g282000.t2.1.308.399
Cre06.g282000.t2.1.308.399Cre06.g282000.t1.3.344.435Cre06.g282000.t1.3.344.435
Citrus clementinaCiclev10014319m.155.243Ciclev10014319m.155.243
Citrus sinensisorange1.1g046057m.276.359orange1.1g046057m.276.359orange1.1g046057m.276.359orange1.1g046057m.452.540orange1.1g046057m.452.540
orange1.1g046057m.452.540orange1.1g046057m.612.700orange1.1g046057m.612.700orange1.1g046057m.612.700
Cucumis sativusCucsa.085800.2.269.352Cucsa.085800.2.269.352Cucsa.085800.2.269.352Cucsa.085800.1.269.352Cucsa.085800.1.269.352
Cucsa.085800.1.269.352Cucsa.085800.2.443.534Cucsa.085800.2.443.534Cucsa.085800.2.443.534Cucsa.085800.1.443.534
Cucsa.085800.1.443.534Cucsa.085800.1.443.534Cucsa.085800.2.607.694Cucsa.085800.2.607.694Cucsa.085800.2.607.694
Cucsa.085800.1.607.694Cucsa.085800.1.607.694Cucsa.085800.1.607.694
Eucalyptus grandisEucgr.D01324.4.304.386Eucgr.D01324.4.304.386Eucgr.D01324.4.304.386Eucgr.D01324.3.304.386Eucgr.D01324.3.304.386
Eucgr.D01324.3.304.386Eucgr.D01324.2.304.386Eucgr.D01324.2.304.386Eucgr.D01324.2.304.386Eucgr.D01324.1.309.391
Eucgr.D01324.1.309.391Eucgr.D01324.1.309.391Eucgr.D01324.4.478.567Eucgr.D01324.4.478.567Eucgr.D01324.4.478.567
Eucgr.D01324.3.478.567Eucgr.D01324.3.478.567Eucgr.D01324.3.478.567Eucgr.D01324.2.478.567Eucgr.D01324.2.478.567
Eucgr.D01324.2.478.567Eucgr.D01324.1.483.572Eucgr.D01324.1.483.572Eucgr.D01324.1.483.572Eucgr.D01324.4.639.727
Eucgr.D01324.4.639.727Eucgr.D01324.4.639.727Eucgr.D01324.3.639.727Eucgr.D01324.3.639.727Eucgr.D01324.3.639.727
Eucgr.D01324.2.639.727Eucgr.D01324.2.639.727Eucgr.D01324.2.639.727Eucgr.D01324.1.644.732Eucgr.D01324.1.644.732
Eucgr.D01324.1.644.732
Fragaria vescamrna19625.1-v1.0-hybrid.209.292mrna19625.1-v1.0-hybrid.209.292mrna19625.1-v1.0-hybrid.209.292mrna19625.1-v1.0-hybrid.384.473mrna19625.1-v1.0-hybrid.384.473
mrna19625.1-v1.0-hybrid.384.473mrna19625.1-v1.0-hybrid.546.633mrna19625.1-v1.0-hybrid.546.633mrna19625.1-v1.0-hybrid.546.633
Glycine maxGlyma13g27480.1.265.348Glyma13g27480.1.265.348Glyma13g27480.1.265.348Glyma15g11500.1.282.365Glyma15g11500.1.282.365
Glyma15g11500.1.282.365Glyma07g39040.2.196.281Glyma07g39040.2.196.281Glyma07g39040.2.196.281Glyma15g11500.1.459.546
Glyma15g11500.1.459.546Glyma15g11500.1.459.546Glyma13g27480.1.442.529Glyma13g27480.1.442.529Glyma13g27480.1.442.529
Glyma07g39040.2.374.462Glyma07g39040.2.374.462Glyma07g39040.2.374.462Glyma15g11500.1.618.706Glyma15g11500.1.618.706
Glyma15g11500.1.618.706Glyma07g39040.2.534.622Glyma07g39040.2.534.622Glyma07g39040.2.534.622Glyma13g27480.1.601.689
Glyma13g27480.1.601.689Glyma13g27480.1.601.689
Gossypium raimondiiGorai.011G013800.6.270.352Gorai.011G013800.6.270.352Gorai.011G013800.6.270.352Gorai.011G013800.5.192.274Gorai.011G013800.5.192.274
Gorai.011G013800.5.192.274Gorai.011G013800.4.192.274Gorai.011G013800.4.192.274Gorai.011G013800.4.192.274Gorai.011G013800.3.192.274
Gorai.011G013800.3.192.274Gorai.011G013800.3.192.274Gorai.011G013800.2.270.352Gorai.011G013800.2.270.352Gorai.011G013800.2.270.352
Gorai.011G013800.1.270.352Gorai.011G013800.1.270.352Gorai.011G013800.1.270.352Gorai.009G178700.6.279.362Gorai.009G178700.6.279.362
Gorai.009G178700.6.279.362Gorai.009G178700.5.279.362Gorai.009G178700.5.279.362Gorai.009G178700.5.279.362Gorai.009G178700.4.157.240
Gorai.009G178700.4.157.240Gorai.009G178700.4.157.240Gorai.009G178700.3.279.362Gorai.009G178700.3.279.362Gorai.009G178700.3.279.362
Gorai.009G178700.2.279.362Gorai.009G178700.2.279.362Gorai.009G178700.2.279.362Gorai.009G178700.1.279.362Gorai.009G178700.1.279.362
Gorai.009G178700.1.279.362Gorai.011G013800.6.444.533Gorai.011G013800.6.444.533Gorai.011G013800.6.444.533Gorai.011G013800.5.366.455
Gorai.011G013800.5.366.455Gorai.011G013800.5.366.455Gorai.011G013800.4.366.455Gorai.011G013800.4.366.455Gorai.011G013800.4.366.455
Gorai.011G013800.3.366.455Gorai.011G013800.3.366.455Gorai.011G013800.3.366.455Gorai.011G013800.2.444.533Gorai.011G013800.2.444.533
Gorai.011G013800.2.444.533Gorai.011G013800.1.444.533Gorai.011G013800.1.444.533Gorai.011G013800.1.444.533Gorai.009G178700.6.454.543
Gorai.009G178700.6.454.543Gorai.009G178700.6.454.543Gorai.009G178700.5.454.543Gorai.009G178700.5.454.543Gorai.009G178700.5.454.543
Gorai.009G178700.4.332.421Gorai.009G178700.4.332.421Gorai.009G178700.4.332.421Gorai.009G178700.3.454.543Gorai.009G178700.3.454.543
Gorai.009G178700.3.454.543Gorai.009G178700.2.454.543Gorai.009G178700.2.454.543Gorai.009G178700.2.454.543Gorai.009G178700.1.454.543
Gorai.009G178700.1.454.543Gorai.009G178700.1.454.543Gorai.009G178700.6.615.703Gorai.009G178700.6.615.703Gorai.009G178700.6.615.703
Gorai.009G178700.5.615.703Gorai.009G178700.5.615.703Gorai.009G178700.5.615.703Gorai.009G178700.4.493.581Gorai.009G178700.4.493.581
Gorai.009G178700.4.493.581Gorai.009G178700.3.615.703Gorai.009G178700.3.615.703Gorai.009G178700.3.615.703Gorai.009G178700.2.615.703
Gorai.009G178700.2.615.703Gorai.009G178700.2.615.703Gorai.009G178700.1.615.703Gorai.009G178700.1.615.703Gorai.009G178700.1.615.703
Gorai.011G013800.6.606.693Gorai.011G013800.6.606.693Gorai.011G013800.6.606.693Gorai.011G013800.5.528.615Gorai.011G013800.5.528.615
Gorai.011G013800.5.528.615Gorai.011G013800.4.528.615Gorai.011G013800.4.528.615Gorai.011G013800.4.528.615Gorai.011G013800.3.528.615
Gorai.011G013800.3.528.615Gorai.011G013800.3.528.615Gorai.011G013800.2.606.693Gorai.011G013800.2.606.693Gorai.011G013800.2.606.693
Gorai.011G013800.1.606.693Gorai.011G013800.1.606.693Gorai.011G013800.1.606.693
Linum usitatissimumLus10020044.225.308Lus10020044.225.308Lus10020044.225.308Lus10006780.228.311Lus10006780.228.311
Lus10006780.228.311Lus10006780.565.653Lus10006780.565.653Lus10006780.565.653Lus10020044.562.650
Lus10020044.562.650Lus10020044.562.650Lus10006780.404.493Lus10006780.404.493Lus10006780.404.493
Lus10020044.401.490Lus10020044.401.490Lus10020044.401.490
Malus domesticaMDP0000191201.257.340MDP0000191201.257.340MDP0000191201.257.340MDP0000151462.257.340MDP0000151462.257.340
MDP0000151462.257.340MDP0000252413.204.287MDP0000252413.204.287MDP0000191201.433.521MDP0000191201.433.521
MDP0000191201.433.521MDP0000151462.433.521MDP0000151462.433.521MDP0000151462.433.521MDP0000585054.156.244
MDP0000585054.156.244MDP0000252413.380.468MDP0000252413.380.468MDP0000191201.594.681MDP0000191201.594.681
MDP0000191201.594.681MDP0000151462.594.681MDP0000151462.594.681MDP0000151462.594.681
Manihot esculentacassava4.1_000528m.264.347cassava4.1_000528m.264.347cassava4.1_000528m.264.347cassava4.1_001042m.91.174cassava4.1_001042m.91.174
cassava4.1_001042m.91.174cassava4.1_000528m.440.528cassava4.1_000528m.440.528cassava4.1_000528m.440.528cassava4.1_001042m.261.348
cassava4.1_001042m.261.348cassava4.1_001042m.261.348cassava4.1_001042m.421.508cassava4.1_001042m.421.508cassava4.1_001042m.421.508
cassava4.1_000528m.601.688cassava4.1_000528m.601.688cassava4.1_000528m.601.688
Mimulus guttatusmgv1a000364m.363.446mgv1a000364m.363.446mgv1a000364m.670.758mgv1a000364m.670.758
Oryza sativaLOC_Os08g09230.2.906.989LOC_Os08g09230.2.906.989LOC_Os08g09230.2.906.989LOC_Os08g09230.1.906.989LOC_Os08g09230.1.906.989
LOC_Os08g09230.1.906.989LOC_Os04g53310.1.334.417LOC_Os04g53310.1.334.417LOC_Os04g53310.1.334.417LOC_Os04g53310.1.508.598
LOC_Os04g53310.1.508.598LOC_Os04g53310.1.508.598LOC_Os04g53310.1.670.758LOC_Os04g53310.1.670.758LOC_Os04g53310.1.670.758
Panicum virgatumPavirv00054440m.151.234Pavirv00054440m.151.234Pavirv00054440m.151.234Pavirv00009477m.238.321Pavirv00009477m.238.321
Pavirv00009477m.238.321Pavirv00019877m.488.571Pavirv00019877m.488.571Pavirv00019877m.488.571Pavirv00009007m.640.723
Pavirv00009007m.640.723Pavirv00009007m.640.723Pavirv00069992m.620.703Pavirv00069992m.620.703Pavirv00069992m.620.703
Pavirv00054440m.325.415Pavirv00054440m.325.415Pavirv00054440m.325.415Pavirv00054440m.487.575Pavirv00054440m.487.575
Pavirv00054440m.487.575Pavirv00069992m.795.882Pavirv00069992m.795.882Pavirv00069992m.795.882Pavirv00009477m.412.502
Pavirv00009477m.412.502Pavirv00009477m.412.502Pavirv00009477m.574.662Pavirv00009477m.574.662Pavirv00009477m.574.662
Pavirv00019877m.663.750Pavirv00019877m.663.750Pavirv00019877m.663.750Pavirv00019877m.824.912Pavirv00019877m.824.912
Pavirv00019877m.824.912Pavirv00009007m.815.902Pavirv00009007m.815.902Pavirv00009007m.815.902
Phaseolus vulgarisPhvul.011G151400.1.281.364Phvul.011G151400.1.281.364Phvul.011G151400.1.281.364Phvul.003G078800.1.198.283Phvul.003G078800.1.198.283
Phvul.003G078800.1.198.283Phvul.011G151400.1.458.545Phvul.011G151400.1.458.545Phvul.011G151400.1.458.545Phvul.003G078800.1.377.463
Phvul.003G078800.1.377.463Phvul.003G078800.1.377.463Phvul.011G151400.1.617.705Phvul.011G151400.1.617.705Phvul.011G151400.1.617.705
Phvul.003G078800.1.536.624Phvul.003G078800.1.536.624Phvul.003G078800.1.536.624
Picea abiesMA_10437241g0010.202.286MA_10437241g0010.202.286MA_10437241g0010.202.286MA_10437241g0010.377.467MA_10437241g0010.377.467
MA_10437241g0010.377.467MA_10437241g0010.540.629MA_10437241g0010.540.629MA_10437241g0010.540.629
Populus trichocarpaPotri.004G014100.2.162.245Potri.004G014100.2.162.245Potri.004G014100.2.162.245Potri.004G014100.1.281.364Potri.004G014100.1.281.364
Potri.004G014100.1.281.364Potri.004G014100.2.337.426Potri.004G014100.2.337.426Potri.004G014100.2.337.426Potri.004G014100.1.456.545
Potri.004G014100.1.456.545Potri.004G014100.1.456.545Potri.004G014100.2.498.586Potri.004G014100.2.498.586Potri.004G014100.2.498.586
Potri.004G014100.1.617.705Potri.004G014100.1.617.705Potri.004G014100.1.617.705
Prunus persicappa001074m.35.118ppa001074m.35.118ppa001074m.35.118ppa001074m.211.299ppa001074m.211.299
ppa001074m.211.299ppa001074m.372.460ppa001074m.372.460ppa001074m.372.460
Ricinus communis29842.m003588.184.26729842.m003588.184.26729842.m003588.184.26729842.m003588.389.47729842.m003588.389.477
29842.m003588.389.47729842.m003588.550.63729842.m003588.550.63729842.m003588.550.637
Setaria italicaSi013121m.535.618Si013121m.535.618Si013121m.535.618Si009214m.272.354Si009214m.272.354
Si009214m.272.354Si015393m.625.708Si015393m.625.708Si015393m.625.708Si009214m.445.535
Si009214m.445.535Si009214m.445.535Si009214m.607.695Si009214m.607.695Si009214m.607.695
Si013121m.706.793Si013121m.706.793Si013121m.706.793Si013121m.868.956Si013121m.868.956
Si013121m.868.956Si015393m.801.887Si015393m.801.887Si015393m.801.887
Selaginella moellendorffii154776.15.97154776.15.97154776.15.97154776.189.279154776.189.279
154776.189.279154776.351.441154776.351.441154776.351.441
Sorghum bicolorSb06g029050.1.309.392Sb06g029050.1.309.392Sb06g029050.1.309.392Sb07g005400.1.782.865Sb07g005400.1.782.865
Sb07g005400.1.782.865Sb06g029050.1.483.573Sb06g029050.1.483.573Sb06g029050.1.483.573Sb06g029050.1.645.733
Sb06g029050.1.645.733Sb06g029050.1.645.733
Thellungiella halophilaThhalv10006781m.209.292Thhalv10006781m.209.292Thhalv10006781m.209.292Thhalv10006631m.209.292Thhalv10006631m.209.292
Thhalv10006631m.209.292Thhalv10006781m.384.477Thhalv10006781m.384.477Thhalv10006781m.384.477Thhalv10006631m.384.477
Thhalv10006631m.384.477Thhalv10006631m.384.477Thhalv10006781m.549.638Thhalv10006781m.549.638Thhalv10006781m.549.638
Thhalv10006631m.549.638Thhalv10006631m.549.638Thhalv10006631m.549.638
Vitis viniferaGSVIVT01012723001.340.428GSVIVT01012723001.340.428GSVIVT01012723001.500.588GSVIVT01012723001.500.588
Volvox carteriVocar20002632m.688.777Vocar20002632m.688.777Vocar20002632m.313.404Vocar20002632m.313.404
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)