y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGossypium raimondii
Cazyme IDGorai.009G223500.2
FamilyCBM22
Protein PropertiesLength: 911 Molecular Weight: 100870 Isoelectric Point: 6.3652
ChromosomeChromosome/Scaffold: 09 Start: 17409511 End: 17413893
Descriptionglycosyl hydrolase family 10 protein / carbohydrate-binding domain-containing protein
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
CBM22241622e-32
  NIIVNHDFYKGLYSWHPNCCNGFIVSANSGNQVGLSPKSGGNYAVIKNRTEHWQGLEQDITRKISPGSTYSVSACVGVSGPLSGSTDVMATLKLLNHGSG
  ASYMFIGKTSVSKGKWEMVEGTFSLPTVPNQVIFYLEGP
CBM221973321.5e-32
  VIINPQFEDGLSNWSGRGCQVVLHDSMADGKIVPETGKVFASASERTQNWNGIQQEITGRVQRKLAYNVTAVVRIFGNNVTTATVQATLWIHTPDRGEQY
  IGIGKVQATDKDWVQLQGKFLLNGSPSRVIIYLEGP
CBM223675086.40393e-43
  NIITNSQLSDGTNGWFPLGNCNLNAASGSPKILPPMARDSLGVHEPLSGRYILVKNRTQTWMGPAQMITDKLKLFLTYQVSAWVRIGSGASGPQNVNVAL
  GVDNQWVNGGQAEIKDGRWHEIGGSFRIEKQPSKVMVYVQGP
GH105648460
  VMQTQNSFPIGSCINRTNIENEDFVDFFVKNFNWAVFENELKWYWTEPQRGNFNYKDADDMLALCQNNKIETRGHCIFWEVQSSVQQWIQALNKIDLMKA
  VQNRLTGLLTRYKGKFRHYDVNNEMLHGSFYKDRLGKDIRTYMFKTANQLDPSATLFVNDYHVEDGRDTRSYPEKYIEQIIDLQLQGAPVGGIGIQGHID
  NPVGPIVCSALDKLGVLGLPIWFTELDVSSLNEHIRGEDLEVMIREAFAHPAVEGVMLWGFWELFMSRDNAHLVDAEGEINEA
Full Sequence
Protein Sequence     Length: 911     Download
MCDSGTCNWW FLMGNCTSGN PTDNIIVNHD FYKGLYSWHP NCCNGFIVSA NSGNQVGLSP    60
KSGGNYAVIK NRTEHWQGLE QDITRKISPG STYSVSACVG VSGPLSGSTD VMATLKLLNH    120
GSGASYMFIG KTSVSKGKWE MVEGTFSLPT VPNQVIFYLE GPPPGVELLI DSVVIRCPSS    180
SKSESTSIGC SAVGDEVIIN PQFEDGLSNW SGRGCQVVLH DSMADGKIVP ETGKVFASAS    240
ERTQNWNGIQ QEITGRVQRK LAYNVTAVVR IFGNNVTTAT VQATLWIHTP DRGEQYIGIG    300
KVQATDKDWV QLQGKFLLNG SPSRVIIYLE GPPPGTDILV NALSVKHAEK IPPLPPPIIE    360
NPDYGVNIIT NSQLSDGTNG WFPLGNCNLN AASGSPKILP PMARDSLGVH EPLSGRYILV    420
KNRTQTWMGP AQMITDKLKL FLTYQVSAWV RIGSGASGPQ NVNVALGVDN QWVNGGQAEI    480
KDGRWHEIGG SFRIEKQPSK VMVYVQGPAA GVDFMVAGLQ IFPVDRVARF KHLARQTDKT    540
RKRDVILQFS GSESSSLFGT SVTVMQTQNS FPIGSCINRT NIENEDFVDF FVKNFNWAVF    600
ENELKWYWTE PQRGNFNYKD ADDMLALCQN NKIETRGHCI FWEVQSSVQQ WIQALNKIDL    660
MKAVQNRLTG LLTRYKGKFR HYDVNNEMLH GSFYKDRLGK DIRTYMFKTA NQLDPSATLF    720
VNDYHVEDGR DTRSYPEKYI EQIIDLQLQG APVGGIGIQG HIDNPVGPIV CSALDKLGVL    780
GLPIWFTELD VSSLNEHIRG EDLEVMIREA FAHPAVEGVM LWGFWELFMS RDNAHLVDAE    840
GEINEAGKRF LALKHEWLSH SHGRIDIQGQ FEFRGFHGTY VVEVETELNK VSRTFVVDKG    900
DSPLVVSIDL *                                                         960
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam02018CBM_4_97.0e-16196336142+
pfam02018CBM_4_91.0e-1924164142+
COG3693XynA2.0e-33592824253+
smart00633Glyco_104.0e-77604850268+
pfam00331Glyco_hydro_102.0e-77569854306+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
GO:0016798hydrolase activity, acting on glycosyl bonds
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAX33301.101791023915putative endo-1,4-beta-xylanase [Populus tremula x Populus tremuloides]
RefSeqXP_002301133.10.0000034175514660predicted protein [Populus trichocarpa]
RefSeqXP_002301133.10179101571049predicted protein [Populus trichocarpa]
RefSeqXP_002301133.10235281491predicted protein [Populus trichocarpa]
RefSeqXP_002301133.101955211314predicted protein [Populus trichocarpa]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1xyz_B1e-3057382839311A Chain A, A Common Protein Fold And Similar Active Site In Two Distinct Families Of Beta-Glycanases
PDB1xyz_A1e-3057382839311A Chain A, A Common Protein Fold And Similar Active Site In Two Distinct Families Of Beta-Glycanases
PDB1i1x_A2e-3059482339268A Chain A, A Common Protein Fold And Similar Active Site In Two Distinct Families Of Beta-Glycanases
PDB1i1w_A2e-3059482339268A Chain A, 0.89a Ultra High Resolution Structure Of A Thermostable Xylanase From Thermoascus Aurantiacus
PDB2bnj_A4e-3059482339268A Chain A, The Xylanase Ta From Thermoascus Aurantiacus Utilizes Arabinose Decorations Of Xylan As Significant Substrate Specificity Determinants
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
EX5706902956179110
EX5706912816178970
DT54420327612520
DT5442032651954324e-17
DT5442031833675210.0000002
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_017_00095.2.21.159Aquca_017_00095.2.21.159Aquca_017_00095.2.21.159Aquca_017_00095.1.34.172Aquca_017_00095.1.34.172
Aquca_017_00095.1.34.172Aquca_017_00095.2.194.330Aquca_017_00095.2.194.330Aquca_017_00095.2.194.330Aquca_017_00095.1.207.343
Aquca_017_00095.1.207.343Aquca_017_00095.1.207.343Aquca_017_00095.4.145.286Aquca_017_00095.4.145.286Aquca_017_00095.3.145.286
Aquca_017_00095.3.145.286Aquca_017_00095.2.365.506Aquca_017_00095.2.365.506Aquca_017_00095.2.365.506Aquca_017_00095.1.378.519
Aquca_017_00095.1.378.519Aquca_017_00095.1.378.519
Arabidopsis lyrata471118.183.313471118.183.313471118.183.313471118.183.313475392.29.168
475392.29.168475392.29.168475392.199.334475392.199.334475392.199.334
471118.350.482471118.350.482471118.350.482471118.350.482489729.27.162
489729.27.162489729.197.344489729.197.344475392.369.511475392.369.511
475392.369.511471118.517.661471118.517.661471118.517.661471118.517.661
Arabidopsis thalianaAT1G10050.1.183.313AT1G10050.1.183.313AT1G10050.1.183.313AT1G10050.1.183.313AT1G58370.1.29.168
AT1G58370.1.29.168AT1G58370.1.29.168AT1G58370.1.199.334AT1G58370.1.199.334AT1G58370.1.199.334
AT1G10050.1.350.482AT1G10050.1.350.482AT1G10050.1.350.482AT1G10050.1.350.482AT4G08160.2.27.162
AT4G08160.2.27.162AT4G08160.1.27.162AT4G08160.1.27.162AT4G08160.2.197.344AT4G08160.2.197.344
AT4G08160.1.197.344AT4G08160.1.197.344AT1G58370.1.369.511AT1G58370.1.369.511AT1G58370.1.369.511
AT1G10050.1.517.661AT1G10050.1.517.661AT1G10050.1.517.661AT1G10050.1.517.661
Brachypodium distachyonBradi1g28627.1.218.356Bradi1g28627.1.218.356Bradi1g28627.1.218.356Bradi1g28627.1.218.356Bradi1g12710.1.17.158
Bradi1g12710.1.17.158Bradi1g28627.1.50.187Bradi1g28627.1.50.187Bradi1g28627.1.50.187Bradi1g28627.1.50.187
Bradi1g28627.1.389.522Bradi1g28627.1.389.522Bradi1g28627.1.389.522Bradi1g28627.1.389.522Bradi1g12710.1.193.343
Bradi1g12710.1.193.343Bradi1g28627.1.557.697Bradi1g28627.1.557.697Bradi1g28627.1.557.697Bradi1g28627.1.557.697
Bradi1g27257.1.12.140Bradi2g02320.1.22.183
Brassica rapaBra031698.175.305Bra031698.175.305Bra031698.175.305Bra031698.175.305Bra027867.202.338
Bra027867.202.338Bra027867.202.338Bra027867.30.169Bra027867.30.169Bra027867.30.169
Bra031698.343.475Bra031698.343.475Bra031698.343.475Bra031698.343.475Bra039768.283.376
Bra039768.283.376Bra039768.432.578Bra039768.432.578Bra027867.373.515Bra027867.373.515
Bra027867.373.515Bra031698.510.654Bra031698.510.654Bra031698.510.654Bra031698.510.654
Carica papayaevm.model.supercontig_160.19.30.168evm.model.supercontig_160.19.30.168evm.model.supercontig_160.19.30.168evm.model.supercontig_160.19.203.339evm.model.supercontig_160.19.203.339
evm.model.supercontig_160.19.203.339evm.model.supercontig_160.18.53.191evm.model.supercontig_160.18.53.191evm.model.supercontig_160.18.226.368evm.model.supercontig_160.18.226.368
evm.model.supercontig_160.19.374.515evm.model.supercontig_160.19.374.515evm.model.supercontig_160.19.374.515
Capsella rubellaCarubv10008217m.78.208Carubv10008217m.78.208Carubv10008217m.78.208Carubv10008147m.217.347Carubv10008147m.217.347
Carubv10008147m.217.347Carubv10008147m.217.347Carubv10008147m.39.178Carubv10008147m.39.178Carubv10008147m.39.178
Carubv10008147m.39.178Carubv10019737m.53.192Carubv10019737m.53.192Carubv10019737m.53.192Carubv10019737m.223.358
Carubv10019737m.223.358Carubv10019737m.223.358Carubv10008217m.244.376Carubv10008217m.244.376Carubv10008217m.244.376
Carubv10008147m.384.516Carubv10008147m.384.516Carubv10008147m.384.516Carubv10008147m.384.516Carubv10000293m.27.162
Carubv10000293m.27.162Carubv10019737m.393.535Carubv10019737m.393.535Carubv10019737m.393.535Carubv10000293m.197.346
Carubv10000293m.197.346Carubv10008217m.411.555Carubv10008217m.411.555Carubv10008217m.411.555Carubv10008147m.551.695
Carubv10008147m.551.695Carubv10008147m.551.695Carubv10008147m.551.695
Citrus clementinaCiclev10000171m.69.207Ciclev10000171m.69.207Ciclev10000171m.69.207Ciclev10000171m.242.378Ciclev10000171m.242.378
Ciclev10000171m.242.378Ciclev10000171m.413.554Ciclev10000171m.413.554Ciclev10000171m.413.554
Citrus sinensisorange1.1g002447m.32.170orange1.1g002447m.32.170orange1.1g002447m.32.170orange1.1g002447m.205.341orange1.1g002447m.205.341
orange1.1g002447m.205.341orange1.1g002447m.376.517orange1.1g002447m.376.517orange1.1g002447m.376.517
Cucumis sativusCucsa.143690.1.234.370Cucsa.143690.1.234.370Cucsa.143690.1.234.370Cucsa.353160.7.199.335Cucsa.353160.7.199.335
Cucsa.353160.7.199.335Cucsa.353160.4.232.368Cucsa.353160.4.232.368Cucsa.353160.4.232.368Cucsa.353160.1.232.368
Cucsa.353160.1.232.368Cucsa.353160.1.232.368Cucsa.353160.7.29.167Cucsa.353160.7.29.167Cucsa.353160.7.29.167
Cucsa.353160.4.62.200Cucsa.353160.4.62.200Cucsa.353160.4.62.200Cucsa.353160.1.62.200Cucsa.353160.1.62.200
Cucsa.353160.1.62.200Cucsa.143690.1.63.201Cucsa.143690.1.63.201Cucsa.143690.1.63.201Cucsa.353160.8.145.286
Cucsa.353160.8.145.286Cucsa.353160.7.370.511Cucsa.353160.7.370.511Cucsa.353160.7.370.511Cucsa.353160.4.403.544
Cucsa.353160.4.403.544Cucsa.353160.4.403.544Cucsa.353160.1.403.544Cucsa.353160.1.403.544Cucsa.353160.1.403.544
Cucsa.143690.1.405.546Cucsa.143690.1.405.546Cucsa.143690.1.405.546
Eucalyptus grandisEucgr.F00108.3.174.310Eucgr.F00108.3.174.310Eucgr.F00108.3.174.310Eucgr.F00108.2.213.349Eucgr.F00108.2.213.349
Eucgr.F00108.2.213.349Eucgr.F00108.1.217.353Eucgr.F00108.1.217.353Eucgr.F00108.1.217.353Eucgr.F00108.3.11.139
Eucgr.F00108.3.11.139Eucgr.F00108.3.11.139Eucgr.F00108.2.50.178Eucgr.F00108.2.50.178Eucgr.F00108.2.50.178
Eucgr.F00108.1.54.182Eucgr.F00108.1.54.182Eucgr.F00108.1.54.182Eucgr.F00109.1.167.303Eucgr.F00109.1.167.303
Eucgr.F00109.1.167.303Eucgr.F02205.1.83.218Eucgr.F02205.1.83.218Eucgr.F00109.1.11.132Eucgr.F00109.1.11.132
Eucgr.F00109.1.11.132Eucgr.F02205.1.253.394Eucgr.F02205.1.253.394Eucgr.F00109.1.338.479Eucgr.F00109.1.338.479
Eucgr.F00109.1.338.479Eucgr.F00108.3.345.486Eucgr.F00108.3.345.486Eucgr.F00108.3.345.486Eucgr.F00108.2.384.525
Eucgr.F00108.2.384.525Eucgr.F00108.2.384.525Eucgr.F00108.1.388.529Eucgr.F00108.1.388.529Eucgr.F00108.1.388.529
Fragaria vescamrna02649.1-v1.0-hybrid.56.191mrna02649.1-v1.0-hybrid.56.191mrna02649.1-v1.0-hybrid.56.191mrna02649.1-v1.0-hybrid.224.359mrna02649.1-v1.0-hybrid.224.359
mrna02649.1-v1.0-hybrid.224.359mrna02649.1-v1.0-hybrid.394.535mrna02649.1-v1.0-hybrid.394.535mrna02649.1-v1.0-hybrid.394.535
Glycine maxGlyma14g10456.2.187.323Glyma14g10456.2.187.323Glyma14g10456.2.187.323Glyma14g10456.1.216.352Glyma14g10456.1.216.352
Glyma14g10456.1.216.352Glyma04g05220.3.28.163Glyma04g05220.3.28.163Glyma04g05220.2.28.163Glyma04g05220.2.28.163
Glyma06g05290.1.29.164Glyma06g05290.1.29.164Glyma17g35060.2.216.352Glyma17g35060.2.216.352Glyma17g35060.2.216.352
Glyma17g35060.1.187.323Glyma17g35060.1.187.323Glyma17g35060.1.187.323Glyma17g35060.2.44.182Glyma17g35060.2.44.182
Glyma17g35060.2.44.182Glyma17g35060.1.15.153Glyma17g35060.1.15.153Glyma17g35060.1.15.153Glyma14g10456.2.15.153
Glyma14g10456.2.15.153Glyma14g10456.2.15.153Glyma14g10456.1.44.182Glyma14g10456.1.44.182Glyma14g10456.1.44.182
Glyma06g05290.1.199.340Glyma06g05290.1.199.340Glyma04g05220.3.198.339Glyma04g05220.3.198.339Glyma04g05220.2.198.339
Glyma04g05220.2.198.339Glyma14g10456.2.358.499Glyma14g10456.2.358.499Glyma14g10456.2.358.499Glyma14g10456.1.387.528
Glyma14g10456.1.387.528Glyma14g10456.1.387.528Glyma17g35060.2.387.529Glyma17g35060.2.387.529Glyma17g35060.2.387.529
Glyma17g35060.1.358.500Glyma17g35060.1.358.500Glyma17g35060.1.358.500
Gossypium raimondiiGorai.009G223500.7.198.333Gorai.009G223500.7.198.333Gorai.009G223500.7.198.333Gorai.009G223500.6.58.193Gorai.009G223500.6.58.193
Gorai.009G223500.5.198.333Gorai.009G223500.5.198.333Gorai.009G223500.5.198.333Gorai.009G223500.4.197.332Gorai.009G223500.4.197.332
Gorai.009G223500.4.197.332Gorai.009G223500.3.198.333Gorai.009G223500.3.198.333Gorai.009G223500.3.198.333Gorai.009G223500.2.197.332
Gorai.009G223500.2.197.332Gorai.009G223500.2.197.332Gorai.009G223500.1.198.333Gorai.009G223500.1.198.333Gorai.009G223500.1.198.333
Gorai.009G223600.1.51.187Gorai.009G223600.1.51.187Gorai.010G029100.1.217.353Gorai.010G029100.1.217.353Gorai.010G029100.1.217.353
Gorai.009G223500.7.24.162Gorai.009G223500.7.24.162Gorai.009G223500.7.24.162Gorai.009G223500.5.24.162Gorai.009G223500.5.24.162
Gorai.009G223500.5.24.162Gorai.009G223500.4.24.162Gorai.009G223500.4.24.162Gorai.009G223500.4.24.162Gorai.009G223500.3.24.162
Gorai.009G223500.3.24.162Gorai.009G223500.3.24.162Gorai.009G223500.2.24.162Gorai.009G223500.2.24.162Gorai.009G223500.2.24.162
Gorai.009G223500.1.24.162Gorai.009G223500.1.24.162Gorai.009G223500.1.24.162Gorai.010G029100.1.45.185Gorai.010G029100.1.45.185
Gorai.010G029100.1.45.185Gorai.009G223500.7.368.509Gorai.009G223500.7.368.509Gorai.009G223500.7.368.509Gorai.009G223500.6.228.369
Gorai.009G223500.6.228.369Gorai.009G223500.5.368.509Gorai.009G223500.5.368.509Gorai.009G223500.5.368.509Gorai.009G223500.4.367.508
Gorai.009G223500.4.367.508Gorai.009G223500.4.367.508Gorai.009G223500.3.368.509Gorai.009G223500.3.368.509Gorai.009G223500.3.368.509
Gorai.009G223500.2.367.508Gorai.009G223500.2.367.508Gorai.009G223500.2.367.508Gorai.009G223500.1.368.509Gorai.009G223500.1.368.509
Gorai.009G223500.1.368.509Gorai.010G029100.1.388.529Gorai.010G029100.1.388.529Gorai.010G029100.1.388.529Gorai.009G223600.1.222.363
Gorai.009G223600.1.222.363
Linum usitatissimumLus10028243.416.553Lus10028243.416.553Lus10028243.416.553Lus10028243.416.553Lus10007243.417.554
Lus10007243.417.554Lus10007243.417.554Lus10007243.417.554Lus10011465.507.643Lus10011465.507.643
Lus10011465.507.643Lus10011465.507.643Lus10037528.728.864Lus10037528.728.864Lus10037528.728.864
Lus10037528.728.864Lus10037528.728.864Lus10037528.469.605Lus10037528.469.605Lus10037528.469.605
Lus10037528.469.605Lus10037528.469.605Lus10011465.332.469Lus10011465.332.469Lus10011465.332.469
Lus10011465.332.469Lus10007243.245.385Lus10007243.245.385Lus10007243.245.385Lus10007243.245.385
Lus10028243.74.211Lus10028243.74.211Lus10028243.74.211Lus10028243.74.211Lus10037528.294.431
Lus10037528.294.431Lus10037528.294.431Lus10037528.294.431Lus10037528.294.431Lus10037528.120.257
Lus10037528.120.257Lus10037528.120.257Lus10037528.120.257Lus10037528.120.257Lus10007243.75.211
Lus10007243.75.211Lus10007243.75.211Lus10007243.75.211Lus10011465.168.305Lus10011465.168.305
Lus10011465.168.305Lus10011465.168.305Lus10028243.245.384Lus10028243.245.384Lus10028243.245.384
Lus10028243.245.384Lus10007242.62.198Lus10007242.62.198Lus10028242.61.197Lus10028242.61.197
Lus10028243.588.731Lus10028243.588.731Lus10028243.588.731Lus10028243.588.731Lus10007243.589.732
Lus10007243.589.732Lus10007243.589.732Lus10007243.589.732Lus10011465.677.819Lus10011465.677.819
Lus10011465.677.819Lus10011465.677.819Lus10028242.232.374Lus10028242.232.374Lus10007242.233.375
Lus10007242.233.375
Malus domesticaMDP0000212739.64.190MDP0000212739.64.190MDP0000212739.64.190MDP0000212739.64.190MDP0000146624.64.190
MDP0000146624.64.190MDP0000146624.64.190MDP0000225641.62.188MDP0000225641.62.188MDP0000225641.62.188
MDP0000212739.225.359MDP0000212739.225.359MDP0000212739.225.359MDP0000212739.225.359MDP0000146624.300.436
MDP0000146624.300.436MDP0000146624.300.436MDP0000212739.394.530MDP0000212739.394.530MDP0000212739.394.530
MDP0000212739.394.530MDP0000225641.223.369MDP0000225641.223.369MDP0000225641.223.369MDP0000225641.404.545
MDP0000225641.404.545MDP0000225641.404.545MDP0000212739.565.706MDP0000212739.565.706MDP0000212739.565.706
MDP0000212739.565.706MDP0000146624.471.612MDP0000146624.471.612MDP0000146624.471.612
Manihot esculentacassava4.1_001252m.30.167cassava4.1_001252m.30.167cassava4.1_001252m.30.167cassava4.1_001252m.204.340cassava4.1_001252m.204.340
cassava4.1_001252m.204.340cassava4.1_001250m.204.340cassava4.1_001250m.204.340cassava4.1_001250m.204.340cassava4.1_001320m.32.169
cassava4.1_001320m.32.169cassava4.1_001320m.32.169cassava4.1_001250m.30.167cassava4.1_001250m.30.167cassava4.1_001250m.30.167
cassava4.1_002200m.47.182cassava4.1_002200m.47.182cassava4.1_001320m.190.326cassava4.1_001320m.190.326cassava4.1_001320m.190.326
cassava4.1_001252m.375.516cassava4.1_001252m.375.516cassava4.1_001252m.375.516cassava4.1_001250m.375.516cassava4.1_001250m.375.516
cassava4.1_001250m.375.516cassava4.1_002200m.217.358cassava4.1_002200m.217.358cassava4.1_001320m.361.502cassava4.1_001320m.361.502
cassava4.1_001320m.361.502
Mimulus guttatusmgv1a000981m.208.344mgv1a000981m.208.344mgv1a000981m.208.344mgv1a027071m.14.153mgv1a027071m.14.153
mgv1a027071m.14.153mgv1a027071m.177.313mgv1a027071m.177.313mgv1a027071m.177.313mgv1a000981m.32.171
mgv1a000981m.32.171mgv1a000981m.32.171mgv1a027071m.348.489mgv1a027071m.348.489mgv1a027071m.348.489
mgv1a000981m.379.519mgv1a000981m.379.519mgv1a000981m.379.519
Oryza sativaLOC_Os03g47010.1.22.161LOC_Os03g47010.1.22.161LOC_Os07g27320.1.220.358LOC_Os07g27320.1.220.358LOC_Os07g27320.1.220.358
LOC_Os07g27320.1.220.358LOC_Os07g27320.1.51.189LOC_Os07g27320.1.51.189LOC_Os07g27320.1.51.189LOC_Os07g27320.1.51.189
LOC_Os07g27320.1.391.524LOC_Os07g27320.1.391.524LOC_Os07g27320.1.391.524LOC_Os07g27320.1.391.524LOC_Os07g27320.1.559.699
LOC_Os07g27320.1.559.699LOC_Os07g27320.1.559.699LOC_Os07g27320.1.559.699LOC_Os03g47010.1.196.350LOC_Os03g47010.1.196.350
LOC_Os01g04300.1.12.156
Panicum virgatumPavirv00018091m.24.162Pavirv00018091m.24.162Pavirv00070694m.15.153Pavirv00070694m.15.153Pavirv00070694m.15.153
Pavirv00070694m.15.153Pavirv00010604m.49.187Pavirv00010604m.49.187Pavirv00010604m.49.187Pavirv00010604m.49.187
Pavirv00010604m.219.356Pavirv00010604m.219.356Pavirv00010604m.219.356Pavirv00010604m.219.356Pavirv00043679m.17.159
Pavirv00043679m.17.159Pavirv00070694m.185.322Pavirv00070694m.185.322Pavirv00070694m.185.322Pavirv00070694m.185.322
Pavirv00010604m.389.522Pavirv00010604m.389.522Pavirv00010604m.389.522Pavirv00010604m.389.522Pavirv00070694m.355.488
Pavirv00070694m.355.488Pavirv00070694m.355.488Pavirv00070694m.355.488Pavirv00018091m.197.343Pavirv00018091m.197.343
Pavirv00043679m.194.339Pavirv00043679m.194.339Pavirv00070694m.523.663Pavirv00070694m.523.663Pavirv00070694m.523.663
Pavirv00070694m.523.663Pavirv00010604m.557.697Pavirv00010604m.557.697Pavirv00010604m.557.697Pavirv00010604m.557.697
Pavirv00009472m.20.173
Physcomitrella patensPp1s299_60V6.1.177.313Pp1s299_60V6.1.177.313Pp1s299_60V6.1.177.313Pp1s299_60V6.1.177.313Pp1s121_107V6.1.167.303
Pp1s121_107V6.1.167.303Pp1s121_107V6.1.167.303Pp1s299_60V6.1.357.491Pp1s299_60V6.1.357.491Pp1s299_60V6.1.357.491
Pp1s299_60V6.1.357.491Pp1s121_107V6.1.515.657Pp1s121_107V6.1.515.657Pp1s121_107V6.1.515.657Pp1s299_60V6.1.526.668
Pp1s299_60V6.1.526.668Pp1s299_60V6.1.526.668Pp1s299_60V6.1.526.668
Phaseolus vulgarisPhvul.001G032300.2.187.323Phvul.001G032300.2.187.323Phvul.001G032300.2.187.323Phvul.001G032300.1.214.350Phvul.001G032300.1.214.350
Phvul.001G032300.1.214.350Phvul.009G075400.1.29.164Phvul.009G075400.1.29.164Phvul.001G032300.2.15.153Phvul.001G032300.2.15.153
Phvul.001G032300.2.15.153Phvul.001G032300.1.42.180Phvul.001G032300.1.42.180Phvul.001G032300.1.42.180Phvul.001G032400.1
Phvul.001G032300.2.358.499Phvul.001G032300.2.358.499Phvul.001G032300.2.358.499Phvul.001G032300.1.385.526Phvul.001G032300.1.385.526
Phvul.001G032300.1.385.526Phvul.009G075400.1.199.340Phvul.009G075400.1.199.340
Picea abiesMA_287044g0010.210.344MA_287044g0010.210.344MA_287044g0010.26.160MA_287044g0010.26.160MA_44877g0010
MA_10432071g0010
Populus trichocarpaPotri.002G113100.1.375.511Potri.002G113100.1.375.511Potri.002G113100.1.375.511Potri.002G113100.1.375.511Potri.002G113100.1.204.341
Potri.002G113100.1.204.341Potri.002G113100.1.204.341Potri.002G113100.1.204.341Potri.002G113100.2.42.178Potri.002G113100.2.42.178
Potri.002G113100.1.42.177Potri.002G113100.1.42.177Potri.002G113100.1.42.177Potri.002G113100.1.42.177Potri.002G113100.1.546.687
Potri.002G113100.1.546.687Potri.002G113100.1.546.687Potri.002G113100.1.546.687Potri.002G113100.2.213.354Potri.002G113100.2.213.354
Prunus persicappa001089m.198.334ppa001089m.198.334ppa001089m.198.334ppa001089m.27.163ppa001089m.27.163
ppa001089m.27.163ppa001089m.369.510ppa001089m.369.510ppa001089m.369.510
Ricinus communis30170.m013645.19.15630170.m013645.19.15630170.m013645.19.15630170.m013645.186.32230170.m013645.186.322
30170.m013645.186.32230170.m013644.113.24930170.m013644.113.24930170.m013644.284.42530170.m013644.284.425
30170.m013645.357.49830170.m013645.357.49830170.m013645.357.498
Setaria italicaSi038956m.20.160Si038956m.20.160Si028759m.49.186Si028759m.49.186Si028759m.49.186
Si028759m.49.186Si028759m.389.522Si028759m.389.522Si028759m.389.522Si028759m.389.522
Si028759m.218.356Si028759m.218.356Si028759m.218.356Si028759m.218.356Si038956m.195.341
Si038956m.195.341Si028759m.557.697Si028759m.557.697Si028759m.557.697Si028759m.557.697
Si000630m.92.241Si034995m.10.155
Selaginella moellendorffii111304.171.301111304.171.301111304.171.301111304.336.477111304.336.477
111304.336.477
Sorghum bicolorSb01g012210.1.24.162Sb01g012210.1.24.162Sb02g010990.1.216.354Sb02g010990.1.216.354Sb02g010990.1.216.354
Sb02g010990.1.216.354Sb02g010990.1.49.186Sb02g010990.1.49.186Sb02g010990.1.49.186Sb02g010990.1.49.186
Sb02g010990.1.387.520Sb02g010990.1.387.520Sb02g010990.1.387.520Sb02g010990.1.387.520Sb01g012210.1.197.339
Sb01g012210.1.197.339Sb02g010990.1.555.696Sb02g010990.1.555.696Sb02g010990.1.555.696Sb02g010990.1.555.696
Sb03g006950.1.12.161Sb03g006980.1.28.186
Thellungiella halophilaThhalv10006640m.182.312Thhalv10006640m.182.312Thhalv10006640m.182.312Thhalv10006640m.182.312Thhalv10023244m.210.346
Thhalv10023244m.210.346Thhalv10023244m.210.346Thhalv10023244m.42.181Thhalv10023244m.42.181Thhalv10023244m.42.181
Thhalv10006640m.349.481Thhalv10006640m.349.481Thhalv10006640m.349.481Thhalv10006640m.349.481Thhalv10028466m.27.162
Thhalv10028466m.27.162Thhalv10023244m.381.523Thhalv10023244m.381.523Thhalv10023244m.381.523Thhalv10006640m.516.660
Thhalv10006640m.516.660Thhalv10006640m.516.660Thhalv10006640m.516.660Thhalv10028466m.197.330Thhalv10028466m.197.330
Vitis viniferaGSVIVT01009272001.233.369GSVIVT01009272001.233.369GSVIVT01009272001.233.369GSVIVT01009272001.60.198GSVIVT01009272001.60.198
GSVIVT01009272001.60.198GSVIVT01009272001.404.545GSVIVT01009272001.404.545GSVIVT01009272001.404.545
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)