y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGossypium raimondii
Cazyme IDGorai.010G207200.6
FamilyPL1
Protein PropertiesLength: 277 Molecular Weight: 30691.8 Isoelectric Point: 7.2492
ChromosomeChromosome/Scaffold: 10 Start: 57286219 End: 57288412
DescriptionPectin lyase-like superfamily protein
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
PL11262674.39999e-40
  VIQDEPLWIVFSTNMVIKLKHELIFNSFKTIDGRGVNVHITGNGCLTLQYVSHIIIHNIHVHHCKPSGNTDIASSPTHVGRRGRSDGDGISIFGSQKIWV
  DHCSLSYCTDGLVDAVMGSTGITISNSYFAHHDEVMLLGHDD
Full Sequence
Protein Sequence     Length: 277     Download
MLPFTCILFM CILASVSRAT FNLSLPHQHP HPESVVLDVQ WSLNASLSRR QTLSENTKDQ    60
CRTGNPIDDC WRCDPNWFNN RQRLADCSIG FARGTLGGKG GRIYTVTDSS DHDTVNPKPG    120
TLRHAVIQDE PLWIVFSTNM VIKLKHELIF NSFKTIDGRG VNVHITGNGC LTLQYVSHII    180
IHNIHVHHCK PSGNTDIASS PTHVGRRGRS DGDGISIFGS QKIWVDHCSL SYCTDGLVDA    240
VMGSTGITIS NSYFAHHDEV MLLGHDDRYI FPFPLA*                             300
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
COG3866PelB2.0e-1278267203+
pfam00544Pec_lyase_C7.0e-20145269147+
smart00656Amb_all6.0e-29139269142+
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
RefSeqNP_196051.20626918299pectate lyase family protein [Arabidopsis thaliana]
RefSeqXP_002268818.1012691276PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002311060.1062717283predicted protein [Populus trichocarpa]
RefSeqXP_002316399.1022693275predicted protein [Populus trichocarpa]
RefSeqXP_002534016.1012711278Pectate lyase precursor, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1pxz_B0652692207A Chain A, 1.7 Angstrom Crystal Structure Of Jun A 1, The Major Allergen From Cedar Pollen
PDB1pxz_A0652692207A Chain A, 1.7 Angstrom Crystal Structure Of Jun A 1, The Major Allergen From Cedar Pollen
PDB3zsc_A0.0000000007842682172A Chain A, Catalytic Function And Substrate Recognition Of The Pectate Lyase From Thermotoga Maritima
PDB1pcl_A0.00000114326771205A Chain A, Unusual Structural Features In The Parallel Beta-Helix In Pectate Lyases
PDB1jta_A0.0008219267151216A Chain A, Unusual Structural Features In The Parallel Beta-Helix In Pectate Lyases
Signal Peptide
Cleavage Site
19
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
DT56798427012700
DT54770520412040
DT54428019911990
DT54770420012000
DT56375619911990
Orthologous Group
SpeciesID
Citrus sinensisorange1.1g017972m
Gossypium raimondiiGorai.010G207200.5
Panicum virgatumPavirv00066998m
Picea abiesMA_1164682g0010MA_170547g0010MA_10433252g0020MA_163033g0010MA_10332686g0010
MA_10429028g0020MA_134286g0010
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny