y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGossypium raimondii
Cazyme IDGorai.011G029600.1
FamilyCBM57
Protein PropertiesLength: 624 Molecular Weight: 68238.4 Isoelectric Point: 7.0039
ChromosomeChromosome/Scaffold: 11 Start: 2174274 End: 2179467
Descriptionreceptor like protein 4
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
CBM572103591.9e-26
  DYSGDHWGGDRYWEPIRTFGQNADEPRSTENSIKQASDAPNFYPEALYQSAVVSTDSQPDLAYTIDVDPNKNYSIWLHFAEIDALVTDAGQRVFDVLLNG
  DTIFKEIDILKMSGDRYTALVLNTTVAVSGRTLTITLHPKEGHRAIINAI
Full Sequence
Protein Sequence     Length: 624     Download
MLRFTLLWLL VFFLSLVSSS ARPAPFAMRI SCGARQNVRT APTYALWYKD FGYTGGIPAN    60
ATTPSFITPP LKTLRYFPLS EGPENCYGIN RVPKGHYTLR IFFGLIKQPD FDDEPLFEIS    120
VEGTLIHSLK SGWTSHDDQV FAEALVFLLD GTVSICFHST GHGDPAIISI EILQVDDKAY    180
YSGPEWGKGV ILKTTSRLTC GTSKPRFDED YSGDHWGGDR YWEPIRTFGQ NADEPRSTEN    240
SIKQASDAPN FYPEALYQSA VVSTDSQPDL AYTIDVDPNK NYSIWLHFAE IDALVTDAGQ    300
RVFDVLLNGD TIFKEIDILK MSGDRYTALV LNTTVAVSGR TLTITLHPKE GHRAIINAIE    360
IFQVIAAESK TSSAEVRALQ ALKRSLGLPN RFAWNGDPCV PKEHPWSGAD CQFDKSGSKW    420
FIDGLDLANQ GLKGFLPDDI SKLIHLQSLN LSGNTIHGVI PSSLGTITSL ELLDLSYNFL    480
NGSIPESLGN LTALRRLNLN GNSLSGRVPG ALGGRLLNGA SFNFTDNAGL CGIPGLPTCG    540
PHLSAGAKVG IAFGVSLSFL LLVICSVCYW KRRQNILRAQ QIAARGAPYA KARTQFSHDI    600
QMSRHHNHGH TRTAAENGPS LLS*                                           660
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN00113PLN001131.0e-1041651499+
pfam11721Malectin7.0e-17200359175+
pfam12819Malectin_like4.0e-6330364351+
PLN03150PLN03150021623605+
Gene Ontology
GO TermDescription
GO:0005515protein binding
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAF16758.1016212624AC010155_11 F3M18.23 [Arabidopsis thaliana]
EMBLCBI30598.102462323624unnamed protein product [Vitis vinifera]
RefSeqNP_174156.1016232626AtRLP4 (Receptor Like Protein 4); protein binding [Arabidopsis thaliana]
RefSeqXP_002305781.10286231596predicted protein [Populus trichocarpa]
RefSeqXP_002509445.1016231629serine-threonine protein kinase, plant-type, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3rj0_A3e-16397546608752A Chain A, Crystal Structure Of Bermuda Grass Isoallergen Bg60 Provides Insight Into The Various Cross-Allergenicity Of The Pollen Group 4 Allergens
PDB3rj0_A0.00000002425512396483A Chain A, Crystal Structure Of Bermuda Grass Isoallergen Bg60 Provides Insight Into The Various Cross-Allergenicity Of The Pollen Group 4 Allergens
PDB3rj0_A0.000001432513451532A Chain A, Crystal Structure Of Bermuda Grass Isoallergen Bg60 Provides Insight Into The Various Cross-Allergenicity Of The Pollen Group 4 Allergens
PDB3rj0_A0.000003446512393459A Chain A, Crystal Structure Of Bermuda Grass Isoallergen Bg60 Provides Insight Into The Various Cross-Allergenicity Of The Pollen Group 4 Allergens
PDB3rj0_A0.000004432512475555A Chain A, Crystal Structure Of Bermuda Grass Isoallergen Bg60 Provides Insight Into The Various Cross-Allergenicity Of The Pollen Group 4 Allergens
Transmembrane Domains
StartEnd
551570
Signal Peptide
Cleavage Site
21
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
JG8507122761874580
ES8006022653606240
EX133552276212960
BF27256223812380
HO809175179502280
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_002_01105.1Aquca_026_00194.1Aquca_036_00074.1
Arabidopsis thalianaAT1G28340.1
Brachypodium distachyonBradi1g26830.1
Brassica rapaBra032897
Carica papayaevm.model.supercontig_27.21
Capsella rubellaCarubv10008578m
Citrus clementinaCiclev10014874mCiclev10014609m
Citrus sinensisorange1.1g013887morange1.1g012913morange1.1g010819morange1.1g009515morange1.1g007860m
orange1.1g007307morange1.1g006793morange1.1g015373morange1.1g009603morange1.1g009236m
orange1.1g006940morange1.1g006035m
Cucumis sativusCucsa.147330.1Cucsa.126850.1
Eucalyptus grandisEucgr.G02346.3Eucgr.E03253.2Eucgr.E03253.1Eucgr.D00605.1
Fragaria vescamrna03872.1-v1.0-hybridmrna29734.1-v1.0-hybrid
Glycine maxGlyma02g11090.2Glyma02g11090.1Glyma01g22406.1Glyma20g32720.1Glyma15g08350.4
Glyma15g08350.3Glyma13g31020.4Glyma13g31020.3Glyma13g24550.1Glyma07g31970.1
Glyma07g31970.2
Gossypium raimondiiGorai.005G138000.3Gorai.005G138000.2Gorai.005G138000.1Gorai.011G029600.2Gorai.006G087900.8
Gorai.006G087900.7Gorai.006G087900.6Gorai.006G087900.5Gorai.006G087900.4Gorai.006G087900.3
Gorai.006G087900.2Gorai.006G087900.1
Linum usitatissimumLus10041488Lus10034275Lus10015417Lus10013994Lus10015320
Malus domesticaMDP0000298053MDP0000124675
Manihot esculentacassava4.1_031190mcassava4.1_008047mcassava4.1_003726mcassava4.1_003546mcassava4.1_034042m
Medicago truncatulaMedtr5g053610.1Medtr2g014290.1
Mimulus guttatusmgv1a002935m
Oryza sativaLOC_Os07g31840.1
Panicum virgatumPavirv00022924mPavirv00022923mPavirv00008373m
Physcomitrella patensPp1s83_48V6.1Pp1s199_124V6.1Pp1s5_311V6.1Pp1s1_97V6.1Pp1s2_327V6.1
Pp1s6_364V6.1
Phaseolus vulgarisPhvul.007G102400.1Phvul.003G027500.1Phvul.006G183300.2Phvul.006G183300.1Phvul.002G230800.1
Phvul.003G239400.1
Picea abiesMA_199958g0010MA_41304g0010
Populus trichocarpaPotri.010G129300.3Potri.010G129300.2Potri.010G129300.1Potri.008G117000.2Potri.008G117000.1
Potri.011G056800.2Potri.011G056800.1Potri.004G047300.4Potri.004G047300.3Potri.004G047300.2
Potri.004G047300.1
Prunus persicappa002857mppa003081m
Ricinus communis29738.m00104930190.m011324
Setaria italicaSi029205m
Selaginella moellendorffii133089
Sorghum bicolorSb02g034070.1
Thellungiella halophilaThhalv10007074m
Vitis viniferaGSVIVT01021096001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)