y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGossypium raimondii
Cazyme IDGorai.011G077500.1
FamilyGT4
Protein PropertiesLength: 698 Molecular Weight: 78240.2 Isoelectric Point: 10.6754
ChromosomeChromosome/Scaffold: 11 Start: 7648877 End: 7654557
DescriptionUDP-Glycosyltransferase superfamily protein
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT45466663.6e-23
  VGSKSNKIPYVKEILSFLSQHAKLSESVLWTPATTRVASLYSAADVYVMNSQGLGETFGRVTVEAMAFGLPVLGTDGGGTKEIVEHNVTGLLHPMGHPGT
  RVLAENLRFLLKNLNARKQMG
Full Sequence
Protein Sequence     Length: 698     Download
MEERLSKGPS SLRQGSLKSS LSGRSTPKGS PTYRRLNSSR TPRREARSGA GGTQWFRSNR    60
VVYWLLLITL WAYLGFYVQS RWAHGHKKEE FLGFNGDPRD KLVDAEQNTR RDLLTDDSLV    120
AVNNITNKTQ VHVDRKIDVI LAKKGNGFTS RKKRSKRRRR NLPKVRDKLK AKTNTESGDA    180
EGQELEILQK NSTFGLLVGP FGSLEDRVLE WSPEKRSGTC DRKGDFARLV WSRRLVLVFH    240
ELSMTGAPIS MMELATEFLS CGATVSAVVL SKKGGLMSEL ARRRIKVIED RADLSFKTAM    300
KADLVIAGSA VCASWIDQYI AHFPAGGSQI AWWIMENRRE YFDRSKLVLH RVKMLIFLSE    360
LQSKQWLTWC QEENIKLRSQ PALVPLAVND ELAFVAGFPC SLNTPSASSV KMLEKRQLLR    420
DAARKEMGLT DNDMLVISLS SINAGKGQLF LLESADLAMN EDPLQTGSEV KKSLDIRQDQ    480
PSLSVKHHLR GLHQKSRNLD VSSTNLRLFT SVNTTNAVSI NGTHRRKMYD SKGAQEQALK    540
ILIGSVGSKS NKIPYVKEIL SFLSQHAKLS ESVLWTPATT RVASLYSAAD VYVMNSQGLG    600
ETFGRVTVEA MAFGLPVLGT DGGGTKEIVE HNVTGLLHPM GHPGTRVLAE NLRFLLKNLN    660
ARKQMGMEGR KMVERKYLKR HMYKRFVEVL TKCMRSK*                            720
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
COG0438RfaG6.0e-20581697117+
cd03798GT1_wlbH_like1.0e-20581693113+
TIGR00072hydrog_prot3.0e-21557688133+
cd03808GT1_cap1E_like2.0e-23568688121+
cd03801GT1_YqgM_like2.0e-27563690130+
Gene Ontology
GO TermDescription
GO:0009058biosynthetic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCAN71826.101069718734hypothetical protein [Vitis vinifera]
EMBLCBI36173.101069718683unnamed protein product [Vitis vinifera]
RefSeqXP_002284822.10106977691PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002298139.10569715681predicted protein [Populus trichocarpa]
RefSeqXP_002528176.101569724686glycosyltransferase, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2jjm_L0.00000004563695259387A Chain A, Crystal Structure Of A Family Gt4 Glycosyltransferase From Bacillus Anthracis Orf Ba1558.
PDB2jjm_K0.00000004563695259387A Chain A, Crystal Structure Of A Family Gt4 Glycosyltransferase From Bacillus Anthracis Orf Ba1558.
PDB2jjm_J0.00000004563695259387A Chain A, Crystal Structure Of A Family Gt4 Glycosyltransferase From Bacillus Anthracis Orf Ba1558.
PDB2jjm_I0.00000004563695259387A Chain A, Crystal Structure Of A Family Gt4 Glycosyltransferase From Bacillus Anthracis Orf Ba1558.
PDB2jjm_H0.00000004563695259387A Chain A, Crystal Structure Of A Family Gt4 Glycosyltransferase From Bacillus Anthracis Orf Ba1558.
Transmembrane Domains
StartEnd
6183
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
ES8022753462575980
FG1474092641894520
EY8095232441954380
CO0804582724006700
HS0643982511684180
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_010_00577.1Aquca_001_00590.2Aquca_001_00590.1
Arabidopsis lyrata889408316473897892474368
Arabidopsis thalianaAT1G19710.1AT1G75420.1AT3G15940.2AT3G15940.1AT1G52420.1
Brachypodium distachyonBradi2g09620.1
Brassica rapaBra025759Bra027200Bra030384
Carica papayaevm.model.supercontig_99.5evm.model.supercontig_253.2
Capsella rubellaCarubv10020237mCarubv10011399mCarubv10013095m
Citrus clementinaCiclev10025538mCiclev10001031mCiclev10024994m
Citrus sinensisorange1.1g023290morange1.1g017123morange1.1g017085morange1.1g012132morange1.1g011954m
orange1.1g004942morange1.1g004760m
Cucumis sativusCucsa.105340.1Cucsa.300870.1
Eucalyptus grandisEucgr.F01601.1Eucgr.F03009.1Eucgr.J03011.1
Fragaria vescamrna15198.1-v1.0-hybridmrna14930.1-v1.0-hybridmrna05979.1-v1.0-hybrid
Glycine maxGlyma04g03170.1Glyma06g03220.1Glyma15g01640.6Glyma15g01640.5Glyma15g01640.4
Glyma15g01640.3Glyma08g22160.2Glyma07g03870.1Glyma13g43720.1
Gossypium raimondiiGorai.009G198800.1Gorai.003G012600.2Gorai.003G012600.1Gorai.007G199800.4Gorai.007G199800.3
Gorai.007G199800.1Gorai.009G132600.4Gorai.009G132600.3Gorai.009G132600.2Gorai.009G132600.1
Gorai.002G058400.1
Linum usitatissimumLus10041786Lus10028338Lus10024281Lus10011469Lus10037523
Malus domesticaMDP0000210114MDP0000312093MDP0000064350MDP0000204168
Manihot esculentacassava4.1_006962mcassava4.1_006727mcassava4.1_002537m
Medicago truncatulaMedtr4g069840.1
Mimulus guttatusmgv1a005641mmgv1a002407m
Oryza sativaLOC_Os01g15780.1
Panicum virgatumPavirv00028369m
Physcomitrella patensPp1s24_249V6.3
Phaseolus vulgarisPhvul.009G060600.1Phvul.010G151400.1Phvul.005G172300.2Phvul.005G172300.1
Picea abiesMA_159042g1120
Populus trichocarpaPotri.005G118800.1Potri.002G031300.1Potri.001G179000.1Potri.001G179000.5
Prunus persicappa005334mppa005118mppa002059m
Ricinus communis30170.m01409429872.m00052635599.m00001450675.m000024
Setaria italicaSi002128m
Selaginella moellendorffii10326098243
Sorghum bicolorSb03g010200.1
Thellungiella halophilaThhalv10007567mThhalv10007509mThhalv10018489mThhalv10020188mThhalv10011288m
Thhalv10011286m
Vitis viniferaGSVIVT01009775001GSVIVT01018875001GSVIVT01017132001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)